KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3385Help
Entry
YE105_C3385       CDS       T01480                                 

Definition
glycosyl hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:yep00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:yep00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3901183..3903054)
Genome map
AA seq 623 aa AA seqDB search
MKKLIPAILLFSTCTYADVIPDAQLKDMWLSPKISAEKVISKMSFEEKLGQILMVDIRSW
SHTDNSDKTAFIEINEAVSKMIRDYHLGSLILFRENLIDTPQTVTLINNLQNARSNLPLF
ISTDQEGGYVTRLRVGTEMPGNMALGATGSSKFAQQAGSIHSYELSSLGFNFNFGPVVDV
NNNQNNPVIGVRSYSNDPVLVAELARSYISGIHKYNVLTSLKHFPGHGNVTSDTHFSLPE
VNIDKAAWQQVELKPFVEVMPVTDAIMTAHVVVPALDNSMLTNNKGEKVGTPATLSKPIL
TDILRNQLKFDGLILTDAMDMGAITSNFERNWSIKQAIMAGNDIVLMPMEIKNRASIEQL
DALYDYLKTEATKDPELKQRIEDSAQRVIYTKLNKRISPEPHDIAIAEKVVASKNHKNIE
NFISEQAITLIKNDNILPYQVKPQNKIIVFSDERPRNELITKHLDDIANKFNVDFIVKNK
VIKLGESDANPEDIAKQIKAQDLIILATYNLKLEPINAQRIIDEANRVNIPLVVISSRNP
YDIAYLSGVKANIAIYGITGFDVTNNVRNSLETNIRSGLRSLFQGPKGKLDVLAEPHGKL
PVDIRTPDNSQILYPRGYGLTTL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattaatacctgcgattctcttatttagcacctgtacttatgcagatgttatt
ccagatgcacaacttaaagatatgtggttgtcaccaaagatatctgctgaaaaagtcata
tcaaaaatgagttttgaagaaaaattggggcaaatattaatggttgatattcgctcctgg
agtcatacggataacagcgacaaaacagcattcattgagattaatgaggctgtcagtaag
atgattcgcgattatcatttaggttctcttattcttttccgtgaaaacctgattgatact
ccacaaacagttacgttaattaataatcttcaaaatgcgcgcagcaatctccctctgttt
attagcaccgatcaggaaggagggtatgtcactcgtctacgagtaggtactgaaatgcca
ggaaatatggcattaggggcaaccggatcatccaagtttgctcagcaggctggaagtatc
cacagttatgaattatctagcttgggttttaactttaattttggccctgtcgttgatgtt
aataataatcagaataaccctgtcattggcgtgcgttcttattccaatgatccggtgttg
gtggcggagttagcccgtagttatattagtggcattcataaatacaatgtactcacctca
ctcaaacattttccaggtcatggaaatgtcacctcagatacacatttttccttgccggaa
gtcaatattgataaagctgcatggcagcaagtcgaactgaaaccctttgttgaagtcatg
ccagtgactgatgcaattatgactgcccatgtggttgtgccagctctggataattcaatg
ttaacaaataataagggcgaaaaagtgggcactccagccacattatcaaagcccatcctg
actgatatcttacgtaatcagctcaagtttgatggcttgatcctgacagatgctatggat
atgggcgcgattaccagtaactttgagcgtaattggtctatcaagcaggccattatggca
ggcaatgatattgtcttaatgccaatggaaattaagaaccgcgccagtattgaacaactc
gatgcactttatgattatttaaaaaccgaagccacaaaagatcctgagcttaaacaacgt
attgaggattcagcacagcgagtcatttacaccaaactgaataagcgtatttctcctgaa
ccgcatgatattgctatcgcggaaaaagttgtcgcatcaaaaaatcataagaatattgaa
aattttatttctgaacaggctattacactaataaaaaatgataatattttaccttatcaa
gtaaaaccacaaaataagataatagtattctctgacgagagacctcgcaacgaactcatt
actaaacatcttgatgatattgctaataaatttaacgttgactttatcgttaagaataaa
gtaataaaactgggtgaaagcgatgcaaatcctgaagatatcgccaaacagattaaagcc
caagatcttattattcttgctacctataatcttaaactcgaaccaattaatgcgcagcgg
atcatcgatgaagccaatagggttaatatccctttagtcgttatatcaagtcgaaatcct
tatgatattgcttatctgtccggcgtaaaggcgaatattgctatttatggtattaccggg
ttcgatgtgaccaataatgtacgaaacagtttagaaactaatatccgcagtgggttaaga
tcgctatttcaggggccaaaaggtaaattagatgtattggccgagccacatgggaagtta
ccggtggatattagaactcctgataatagccagatactctatccacgtggttatggatta
acgacgttataa

DBGET integrated database retrieval system