KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3596Help
Entry
YE105_C3596       CDS       T01480                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YE105_C3596
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YE105_C3596
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YE105_C3596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(4148874..4150181)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSLRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDDLSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcactacgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgtactttggcgcagcacggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggcggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatctgtcaggctggcaggttgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttcccgca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccgggtagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggtgtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgctgcccgtctggct
gccgacgttcttggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgat
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagccgcggtctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagccaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgac
ctgtcggcgatgggttacaaataccagtttattactctggcgggcatccacagcatgtgg
ttcaacatgttcgatctggcgcatgcttacgcacagggagaaggcatgaaacactatgtt
gagaaggttcagcagcccgaatttgccgctgttgagcgcggctacactttcgcctcccat
caacaggaagtgggtaccggctactttgataaagtcaccaatatcattcagggcggcgag
tcttccgtgacagcattgaccggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system