KEGG   Yersinia enterocolitica subsp. palearctica 105.5R(r): YE105_C3596Help
Entry
YE105_C3596       CDS       T01480                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
yep  Yersinia enterocolitica subsp. palearctica 105.5R(r)
Pathway
yep00630  Glyoxylate and dicarboxylate metabolism
yep01100  Metabolic pathways
yep01110  Biosynthesis of secondary metabolites
yep01120  Microbial metabolism in diverse environments
yep01200  Carbon metabolism
Module
yep_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yep00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YE105_C3596
Enzymes [BR:yep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YE105_C3596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ADZ44090
Position
complement(4148874..4150181)
Genome map
AA seq 435 aa AA seqDB search
MTTSRTQQIQQLEQEWKSLRWEGIIRPYSAEEVIKLRGSVNPECTLAQHGAKRLWELLHG
KSRKDYINCLGALTGGQALQQAKAGVEAIYLSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPHDSEFITGDRTAEGFFRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAIHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDDLSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAVERGYTFASHQQEVGTGYFDKVTNIIQGGE
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgactacctctcgtactcaacaaattcagcaattggaacaggaatggaaatcactacgc
tgggagggcattattcgcccgtatagtgctgaagaagtgattaaattacgtggctcagtc
aaccctgagtgtactttggcgcagcacggtgcgaagagattgtgggaattactgcacggc
aaatcgcgcaaagattatatcaactgtttaggtgcattaaccggcggtcaggcactgcaa
caggcgaaggccggggttgaggccatttatctgtcaggctggcaggttgcggctgatgct
aataccgcatcaagcatgtacccggatcaatcgctgtacccggttgactccgttcccgca
gtggttaaacgtatcaataacagtttccgtcgcgcagatcagattcaatggtcgaataat
attgagccgggtagcaaaggttataccgactatttcctgccgattgtagcagatgcggaa
gccggttttggtggtgtactgaatgcgttcgaattgatgaaggctatgattgaggcgggt
gctgccggcgtacatttcgaagatcaactggcagccgtgaagaaatgtggtcatatgggc
ggtaaagttttggtaccgactcaggaagcgattcagaagttggtcgctgcccgtctggct
gccgacgttcttggtgtaccaacactgctgattgcccgtaccgatgctgatgccgctgat
ttgctgacttctgattgtgacccgcatgatagcgaattcattactggcgatcgcactgct
gaaggattcttccgcactcatgctggtattgagcaagctatcagccgcggtctggcttat
gccccgtatgccgatttggtgtggtgcgaaacctcaacgccagacctggcgttagccaaa
cgttttgctgatgcgattcacgcacaattccctggtaaattattggcttacaactgttcg
ccatcatttaactggaaaaagaacctgacggaccaacagattgccagcttccaggatgac
ctgtcggcgatgggttacaaataccagtttattactctggcgggcatccacagcatgtgg
ttcaacatgttcgatctggcgcatgcttacgcacagggagaaggcatgaaacactatgtt
gagaaggttcagcagcccgaatttgccgctgttgagcgcggctacactttcgcctcccat
caacaggaagtgggtaccggctactttgataaagtcaccaatatcattcagggcggcgag
tcttccgtgacagcattgaccggctcgacggaagaacagcaattttag

DBGET integrated database retrieval system