KEGG   Yarrowia lipolytica: YALI0A02310gHelp
Entry
YALI0A02310g      CDS       T01033                                 

Definition
YALI0A02310p
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
yli  Yarrowia lipolytica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YALI0A02310g
   00052 Galactose metabolism
    YALI0A02310g
   00500 Starch and sucrose metabolism
    YALI0A02310g
   00520 Amino sugar and nucleotide sugar metabolism
    YALI0A02310g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YALI0A02310g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
A:join(290783..290818,291364..292818)
Genome map
AA seq 496 aa AA seqDB search
MSKHHLKTQSAVAFDNSATTVAASQMRNALNKLSDSVEDPAQKRRFENEMDNFFSLFRRY
LVDKAKGNALDWDRIQPPKAEQVIDYKDIDQDVGAEFLNKLAVLKLNGGLGTSMGCVGPK
SVIEVRDGKSFLDLSVRQIEHLNRQYNVDVPFILMNSFNTDEDTQTIIKKYQGHKINIKT
FNQSRFPRVFKDSNLPVPKSFDDRIDAWYPPGHGDLFESLHNSGVLDELIAEGKEIIFVS
NVDNLGAVVDLSILKHMSTTGSEYIMELTDKTRADVKGGTLIDYDGQVRLLEIAQVPKEH
TEEFKSIKKFKYFNTNNLWINLKAIKRVVENNELDSEIIPNEKSITIGKNDIPVLQLETA
VGAAIRHFKGCMGVNVPRRRFLPVKTCSDLLLVKSDLYTLHAGRLEMDPSRFGGSPLIKL
GGHYKKVSDFQKRIPHMPKILELDHLTITGNVMLGKGVTLKGTVICVCEEGKKIDIPNGS
VLENVVITGSLSILEH
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagcaccatctgaagacccagagtgccgttgcattcgacaactccgccaccacc
gtggctgcttcgcagatgcgaaacgccctcaacaagctctccgactccgtcgaggacccc
gcccagaagcgacgattcgagaacgagatggacaacttcttctctctcttccgacgatac
ctggtcgacaaggccaagggcaacgctctcgactgggaccgaatccagcccccgaaggct
gagcaggtcattgactacaaggacattgaccaggatgttggcgccgagttcctcaacaag
cttgctgttctcaagcttaacggtggtctcggtacctccatgggctgcgtcggccccaag
tccgtcattgaggttcgagatggcaagtccttcctcgacctgtctgtgcgacagatcgag
cacctcaaccgacagtacaacgtcgacgtgcccttcattctcatgaactctttcaacacc
gacgaggacacccagaccatcatcaagaagtaccagggccacaagatcaacatcaagacc
tttaaccagtcgcggttcccccgagtctttaaggactccaacctgcccgtgcccaagagc
ttcgatgaccgaatcgatgcctggtatccccccggacacggagatctgtttgagtctctg
cacaactccggcgttctggacgagctcattgccgagggcaaggagatcatcttcgtctcc
aacgttgataaccttggtgctgttgtggatctcagcattctcaagcacatgtccaccacc
ggctctgagtacatcatggagctgaccgacaagacccgagctgatgtcaagggaggaacc
ctgatcgactacgatggccaggtccgacttctcgagattgcccaggtccccaaggagcac
accgaggagttcaagtccatcaagaagttcaagtacttcaacactaacaacctgtggatc
aacctcaaggccattaagcgagtcgtcgagaacaacgagctcgacagcgaaatcatcccc
aacgagaagagcatcaccattggcaagaacgacatccccgttctgcagctcgagaccgcc
gtcggtgctgccatccgacacttcaagggctgcatgggtgtcaacgttccccgacgacga
ttcctgcccgtcaagacctgttctgatcttctgctggtcaagtccgatctctacaccctc
cacgccggccgacttgagatggaccccagccgatttggcggttctcctctcatcaagctc
ggtggccactacaagaaggtcagcgacttccagaagcgaatcccccacatgcccaagatt
ttggagcttgaccatctgaccatcactggtaacgttatgctcggcaagggcgtcactctc
aagggcaccgttatctgtgtctgtgaggagggcaagaagattgacatccccaacggctct
gtgctggagaacgttgtcattacaggatctctcagtattctggagcattaa

DBGET integrated database retrieval system