KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2714Help
Entry
YPA_2714          CDS       T00369                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPA_2714
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YPA_2714
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    YPA_2714
Enzymes [BR:ypa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YPA_2714
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3017501..3018604)
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAKGHRIVIVTFGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILASADKLLLLTDQAGLYTADPR
NNPEAELIREVHGIDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQVG
VIADVIDGTPVGTRFHSLETPLENRKRWIFGAPPAGEITVDDGAVFAIMERGSSLLPKGI
RSVKGDFSRGEVIRIRNLNGRDLAHGVSRYNSDALRMLAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagacattggttgtgaaattggggacgagtgtactgaccgggggttcc
cgccgtcttaaccgtgcccatattgttgaattggtgcgtcaatgtgcccagcaacacgca
aaaggtcatcgtattgttattgtcacctttggggcgattgctgcgggtcgtgaacattta
gggtatccagagttgcccgccactattgcctcgaaacaattgctagccgcggttgggcaa
agccggttaattcagctctgggaacaactgttttcaatttatggcattcatatcggccag
atgctgctaacccgcgcagatttagaggatcgtgagcgttttcttaatgcccgcgatacc
atgaatgcgttgcttgataaccgcattgtaccggtgatcaatgagaacgacgccgtcgct
actgctgaaatcaaagtgggcgataacgataatctctccgcattggcggccattttggcc
agtgcagataagctactgttgttgaccgatcaggcggggttgtacaccgctgatccgcgt
aacaatccagaagcggagttaattcgcgaagtgcatggcattgatgatgtcctgcgcggg
atggccggagacagcgtttcggggctcgggacggggggcatggcgactaaactgcaagcg
gcggatgtcgcgtgccgtgcgggtattgatgtggtgattgccgcaggtagccaggtgggt
gtgattgccgatgtgattgacggtacgccagtcggtacccgtttccactcattggaaaca
ccattagaaaaccgtaaacgttggatttttggtgcgccaccggcaggtgaaatcacagtg
gacgacggtgctgtatttgcgatcatggaacggggcagttcgctgctgccaaaaggcatt
cgcagcgttaaaggggacttctcccgtggtgaagtgatccgtatccgtaatctcaatggg
cgggatttagcacacggtgtttcacgctataacagtgatgcattgcgcatgttagcgggg
catcactcgcaacaaatcagtgaaatcctcggatatgaatacggcccggtggctgttcat
cgtgatgatatgattgtcagctaa

DBGET integrated database retrieval system