KEGG   Yersinia pestis Angola: YpAngola_A1681Help
Entry
YpAngola_A1681    CDS       T00635                                 

Gene name
agaN
Definition
alpha-galactosidase (EC:3.2.1.22)
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypg  Yersinia pestis Angola
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ypg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YpAngola_A1681 (agaN)
  Lipid metabolism
   00561 Glycerolipid metabolism
    YpAngola_A1681 (agaN)
   00600 Sphingolipid metabolism
    YpAngola_A1681 (agaN)
Enzymes [BR:ypg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     YpAngola_A1681 (agaN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1733307..1735433
Genome map
AA seq 708 aa AA seqDB search
MNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEALNRPVANSRLDSDIPLTL
CPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTIISEDTSAGLRLVSELQMCP
DSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNGRWIKEFQRHSLKLDHGGY
IQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLAWSGNHRLRADCKSDGRRQVQAEA
LYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQNIVPSLAEKPRPVHLNTW
EGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLSSLGDWYIDAEKYPQGLNP
IIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYPLLKGRDQLLLDLSNPAVF
DYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQTEQLYRLFDQLNLHFPHIE
FESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSYFFPPEVMGAHIGGTPCHT
TARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIALHKQLRPLLHSGNTIRLDH
PDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLNPSTHYQIEVLDMPDSMHK
PRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILIQLSAVN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaatactacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctct
ccctacgcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatg
gaagccttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctc
tgccctgaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggc
gaagattggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacg
attattagcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgccca
gacagtggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccga
atcgatcggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttc
aatggccgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttat
attcaggaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtaggg
aaagcaggcttcagtgagcaacagggcgaggtctggggcttgcatctggcctggagtgga
aaccatcgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagcc
ctctatttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtc
tacgcgacctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtg
cgccagaatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgg
gaaggcatctattttaagcatgacccagactacattattcagatggtgaaaaacgcggcc
aaaattggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgat
ttaagttcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaacccc
attattgaagcagtgaatgaatacggtatggagtttggtatctgggtggaacctgaaatg
atcaatcaggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggc
tacccgctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttc
gactacctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaa
tgggatttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaa
cagaccgagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaa
tttgaatcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccac
cgtttctggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatg
agctacttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccatacc
accgccagaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggg
gtcgagcttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatatt
gcgctacataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccat
ccggataaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtc
ctgatcagccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggt
cttaacccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaa
ccacgaaataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagt
ggcgattggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatc
ctgatacagctttcagccgtaaattaa

DBGET integrated database retrieval system