KEGG   Yersinia pestis KIM 10 (biovar Mediaevalis): y0654Help
Entry
y0654             CDS       T00092                                 

Gene name
cysQ
Definition
adenosine-3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
ypk  Yersinia pestis KIM 10 (biovar Mediaevalis)
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ypk00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
737236..737979
Genome map
AA seq 247 aa AA seqDB search
MMLEQIGQLAREAGVAIMAVYQGDKPLDIAHKKDDSPVTAADLAAHQIIKAGLARLTPDI
PLLSEEDPPAWDVRQHWQRYWLVDPLDGTKEFLNRNGEFTVNIALIDQGEPVLGVVYVPV
TEVMYSAANGQAWKEECGRRMQIQVRDAQPPLVVVSRSHSDAELEDYLSQLGEHQTISVG
SSLKFCLVAEGKAQLYPRFGPTNVWDTAAGHAVAIAAGAQVHDWQGKTLSYTPRESFLNP
GFRVSLF
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgatgttagagcaaattggccagttggcccgtgaggcaggcgtggcgattatggcggtc
tatcagggcgacaaaccccttgatattgcgcataaaaaggatgattcaccggtgacggcg
gctgatttggcggctcaccagattatcaaagctgggttggcgcgattaaccccggatatt
ccgctactctctgaagaggatccacccgcttgggatgtgcgccagcactggcaacgctac
tggctggttgacccgctggacggtactaaagagttcctcaatcgtaacggtgaattcacc
gtcaacatcgctttgattgaccaaggtgaaccggtactgggcgtcgtctatgtaccggta
accgaagtgatgtacagcgcggcaaacggacaggcttggaaagaagagtgtggcagacgt
atgcagattcaggtgcgtgatgcccagcctccgttggtcgtggtgagccgctctcacagc
gatgctgaattggaagactatttatcacaactgggggagcatcaaactatttcggtgggc
tcatcacttaaattctgcttggtggcggaagggaaagcgcaactgtacccgcgttttggg
ccaactaacgtctgggatacggcggctggtcatgccgtcgccatcgctgccggggcgcaa
gtacacgattggcagggaaagacactgtcttataccccacgtgaatctttcttgaacccc
ggtttcagagtttcgttattttag

DBGET integrated database retrieval system