KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3744Help
Entry
YP_3744           CDS       T00165                                 

Gene name
deoA
Definition
(GenBank) Thymidine phosphorylase
  KO
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YP_3744 (deoA)
Enzymes [BR:ypm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YP_3744 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(4265550..4266968)
Genome map
AA seq 472 aa AA seqDB search
MMHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFING
IRDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTG
GVGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIQN
VGVAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSG
AFMPTYSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYR
NPRLLEVTMALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVE
RYDSYLPVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMAR
LGTRVDGQQPLAVIHANNEDDWQQEAEVVRAAITLGNNTPEETPVIYRRITE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
ttgatgcacagtaggctgaaggcctgctgtgtcgctatttccgaaagcgcctgtgggcgg
ctttcatcccatattccggtcaagcagggggatgccttgtttctggcacaagaaattatc
cgtaaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatggg
atccgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttc
cacgacatgagcatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtact
gtgctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggt
ggcgtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcctgcggcggctat
gtgccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggag
gcgatccccggttttgatattttcccggatgataatgcgttccgcaaaattattcagaat
gttggtgtggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttac
gcgacccgcgatattacggcaacagtcgattctattccattgattacggcctctattctg
gccaaaaaattggcggaagggctggatgcattggtcatggacgtgaaggtcggctccggt
gcctttatgccaacctactcgttgtcggctgatttggcgcaggcgattgttggtgtggca
aacggtgcgggttgcaaaaccacggcgctactgacggacatgaaccaagtcctggcgtcc
agcgccggtaatggggtcgaagtccgcgaagctgtgcgtttcctgacgggcgaatatcgc
aacccacgtttgctggaagtgactatggcgctgtgtgttgaaatgttgctgtcaggcggt
ttagcgcacgatgaagccgatgcccgtgccaagctgcaagccgttttggataatggcaaa
gcggcggaagtctttggccgtatggtggccgcgcaaaaaggcccggcagactttgttgaa
cgctatgacagctacctgcccgttgctaccctaagcaaaccggtatttgctgaacagacg
ggaatcattactgcaatggatacccgcgccttgggtatggcggtggtcgccctcggcggg
ggacgccgtcgggcaacggatcccattgattatagtgtagggctgacggagatggcccgt
ttgggtacccgtgttgatgggcagcagccgcttgcggtgatccatgccaataacgaagat
gactggcagcaggaggcagaggttgtgcgtgcggccatcaccttagggaataacacgcca
gaagaaacgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system