KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2398Help
Entry
YPN_2398          CDS       T00370                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ypn00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:ypn00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ypn00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2679243..2681369
Genome map
AA seq 708 aa AA seqDB search
MNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEALNRPVANSRLDSDIPLTL
CPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTIISEDTSAGLRLVSELQMCP
DSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNGRWIKEFQRHSLKLDHGGY
IQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLAWSGNHRLRADCKSDGRRQVQAEA
LYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQNIVPSLAEKPRPVHLNTW
EGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLSSLGDWYIDAEKYPQGLNP
IIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYPLLKGRDQLLLDLSNPAVF
DYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQTEQLYRLFDQLNLHFPHIE
FESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSYFFPPEVMGAHIGGTPCHT
TARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIALHKQLRPLLHSGNTIRLDH
PDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLNPSTHYQIEVLDMPDSMHK
PRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILIQLSAVN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgaatactacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctct
ccctacgcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatg
gaagccttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctc
tgccctgaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggc
gaagattggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacg
attattagcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgccca
gacagtggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccga
atcgatcggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttc
aatggccgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttat
attcaggaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtaggg
aaagcaggcttcagtgagcaacagggcgaggtctggggcttgcatctggcctggagtgga
aaccatcgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagcc
ctctatttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtc
tacgcgacctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtg
cgccagaatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgg
gaaggcatctattttaagcatgacccagactacattattcagatggtgaaaaacgcggcc
aaaattggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgat
ttaagttcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaacccc
attattgaagcagtgaatgaatacggtatggagtttggtatctgggtggagcctgaaatg
atcaatcaggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggc
tacccgctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttc
gactacctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaa
tgggatttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaa
cagaccgagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaa
tttgaatcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccac
cgtttctggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatg
agctacttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccatacc
accgccagaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggg
gtcgagcttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatatt
gcgctacataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccat
ccggataaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtc
ctgatcagccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggt
cttaacccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaa
ccacgaaataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagt
ggcgattggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatc
ctgatacagctttcagccgtaaattaa

DBGET integrated database retrieval system