KEGG   Yersinia pestis Pestoides F: YPDSF_3826Help
Entry
YPDSF_3826        CDS       T00505                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
ypp00010  Glycolysis / Gluconeogenesis
ypp00030  Pentose phosphate pathway
ypp00051  Fructose and mannose metabolism
ypp00052  Galactose metabolism
ypp00680  Methane metabolism
ypp01100  Metabolic pathways
ypp01110  Biosynthesis of secondary metabolites
ypp01120  Microbial metabolism in diverse environments
ypp01130  Biosynthesis of antibiotics
ypp01200  Carbon metabolism
ypp01230  Biosynthesis of amino acids
ypp03018  RNA degradation
Module
ypp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ypp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPDSF_3826
   00030 Pentose phosphate pathway
    YPDSF_3826
   00051 Fructose and mannose metabolism
    YPDSF_3826
   00052 Galactose metabolism
    YPDSF_3826
  Energy metabolism
   00680 Methane metabolism
    YPDSF_3826
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    YPDSF_3826
Enzymes [BR:ypp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     YPDSF_3826
Protein phosphatases and associated proteins [BR:ypp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     YPDSF_3826
Messenger RNA biogenesis [BR:ypp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     YPDSF_3826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ABP42169
JGI: YPDSF3826
UniProt: A4TSA7
Position
complement(4394843..4395826)
Genome map
AA seq 327 aa AA seqDB search
MVKKIGVLTSGGDAPGMNAAIRGVVRAALSAGLDVFGIEDGYLGLYENRMKKLDRYSVSD
MINRGGTFLGSARFPEFRDPEVRKVALKNMHERGIDGLVVIGGDGSYAGADLLTKEGGIH
CVGLPGTIDNDVAGTDYTIGFFTALETVVEAIDRLRDTSSSHQRISIVEVMGRYCGDLTL
AAAIAGGCEFIAIPEVEFKRDDLVAEIKAGIAKGKKHAIVAITEKLDDIDSLAKYIEKET
GRETRGTVLGHIQRGGAPVAYDRILASRMGAYAVDLLLQDHDYKKGGFCVGVQNEKMVHE
LISVCIAPENKKSKFKEDWYDTAKKLF
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggttaagaaaattggtgtcctaacaagtggtggtgatgcacccggtatgaatgctgct
attcgcggggttgttcgtgccgctttgtcagcagggttagacgttttcggtattgaagat
ggctatcttggcttatatgaaaatcgtatgaagaagctggatcgctatagcgtgtcagat
atgattaaccgtggcggtactttcctcggatctgctcgtttcccagaattccgcgatccg
gaagtgcgtaaagttgccctcaagaatatgcatgagcgtggcattgatggcttggttgtt
atcggtggtgatggttcttatgctggtgcggacctgctgacaaaagaagggggaattcac
tgtgttggtttaccgggcactatcgataacgatgtggcgggtactgactacaccatcggt
tttttcaccgcactggaaacggtagtggaagccattgaccgcttacgcgatacctcttct
tcccaccaacgtatctctatcgtggaagtgatgggccgctattgcggtgatttaacgttg
gcagccgcgattgccggtggttgtgagtttattgcgatccctgaagttgaatttaaacgt
gatgatctggttgctgaaatcaaagcgggcatcgcgaaaggtaaaaagcacgcgattgtt
gctattactgaaaagctggatgatatcgattcattggctaagtacattgaaaaagagacg
ggccgtgaaactcgtggcaccgtgttaggccatatccaacgtggtggtgctccggtggct
tatgaccgtattcttgcttcccgtatgggggcttatgctgtcgatttgctgttacaggac
cacgattacaaaaaaggtggtttctgcgtcggtgtacagaatgagaagatggtgcatgag
ttaatttctgtgtgtatcgcgccagagaataagaaaagtaaatttaaagaagattggtac
gatacagcgaagaaactgttctaa

DBGET integrated database retrieval system