KEGG   Candidatus Zinderia insecticola: ZICARI_088Help
Entry
ZICARI_088        CDS       T01304                                 

Gene name
trpB
Definition
putative tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zin  Candidatus Zinderia insecticola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZICARI_088 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZICARI_088 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZICARI_088 (trpB)
Enzymes [BR:zin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZICARI_088 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(84836..86014)
Genome map
AA seq 392 aa AA seqDB search
MKYNFPNKNGYFGKHGGKYVSEILINILNKLEKKYFFYRYKFNFINKYYKELKNFIGRPT
SIYFAKRLTKFLKGAKIFFKREDLNHTGAHKINNVIGQAILAKIMNKKRIIAETGAGQHG
LATSTICAKFGIKCTIYMGENDIKRQSENVKKMKLLGSKIISVKTGTKTLKDALNEAMKD
WIKNVKNTFYIIGTIAGPHPYPMIVRDFQSIIGYESILQIFENKINIPKYIIASIGGGSN
SIGIFYSYIKKNNIKLIGVEAAGKGLHTLLNSSSLNLGKLGVLHGNKTYLLQNKNYQILS
THSISAGLDYPGIGPEHSLLKDLNRIDYEFIINKEALKSFIIFCKIEGIIPALESCHAIA
YAMKLAKNLSKNKIILVNLSGRGEKDINNINL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataattttcctaataaaaatggttatttcggtaaacatggaggaaaatatgtt
tctgaaattttaattaacatattaaataaattagaaaaaaaatattttttttatagatat
aaatttaattttataaataaatattataaagaattaaaaaattttataggtagacctact
tcaatttattttgcaaaaagattgacaaaatttttaaaaggtgcaaaaatattttttaaa
agagaagatttaaatcatactggtgctcataaaattaataatgttataggacaagctatt
ttagcaaaaattatgaataaaaaaagaataatagcagaaacaggagcaggacaacatgga
ttagctacttcaacaatatgtgctaaatttggtattaaatgtactatatatatgggagaa
aatgatattaaaagacaatctgaaaatgttaaaaaaatgaaattattgggttctaaaatt
atatctgtaaaaacaggaacaaaaactttaaaagatgctttaaatgaagcaatgaaagat
tgaataaaaaatgtaaaaaacactttttatataataggaacaattgcaggacctcatcct
tatccaatgatagtaagagattttcaatcaattattggttatgaaagtattctacaaatt
tttgaaaacaaaattaatattcctaaatatataatagcatctataggaggtggctcaaat
tctattggaatattttattcttatataaaaaaaaataatattaaactaataggtgtagaa
gctgcaggtaaaggtttacatacattattaaattcttcttcattaaatttaggaaaatta
ggtgtattacatggtaataaaacatatttattacaaaataaaaattatcaaattttatct
acacattcaatatctgcaggattagattatccaggaataggcccagaacattctttatta
aaagatttaaatagaattgattatgaatttataattaataaagaagctttaaaatcattt
attattttttgtaaaatagaaggaattattccagctcttgaatcatgtcatgctattgct
tatgctatgaaattagcaaaaaatttatctaaaaacaaaattattttagtaaacctttca
ggtagaggagaaaaagatataaataatataaatttataa

DBGET integrated database retrieval system