KEGG   Candidatus Zinderia insecticola: ZICARI_088Help
Entry
ZICARI_088        CDS       T01304                                 

Gene name
trpB
Definition
(GenBank) putative tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
zin  Candidatus Zinderia insecticola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:zin00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    ZICARI_088 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ZICARI_088 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ZICARI_088 (trpB)
Enzymes [BR:zin01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ZICARI_088 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(84836..86014)
Genome map
AA seq 392 aa AA seqDB search
MKYNFPNKNGYFGKHGGKYVSEILINILNKLEKKYFFYRYKFNFINKYYKELKNFIGRPT
SIYFAKRLTKFLKGAKIFFKREDLNHTGAHKINNVIGQAILAKIMNKKRIIAETGAGQHG
LATSTICAKFGIKCTIYMGENDIKRQSENVKKMKLLGSKIISVKTGTKTLKDALNEAMKD
WIKNVKNTFYIIGTIAGPHPYPMIVRDFQSIIGYESILQIFENKINIPKYIIASIGGGSN
SIGIFYSYIKKNNIKLIGVEAAGKGLHTLLNSSSLNLGKLGVLHGNKTYLLQNKNYQILS
THSISAGLDYPGIGPEHSLLKDLNRIDYEFIINKEALKSFIIFCKIEGIIPALESCHAIA
YAMKLAKNLSKNKIILVNLSGRGEKDINNINL
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaatataattttcctaataaaaatggttatttcggtaaacatggaggaaaatatgtt
tctgaaattttaattaacatattaaataaattagaaaaaaaatattttttttatagatat
aaatttaattttataaataaatattataaagaattaaaaaattttataggtagacctact
tcaatttattttgcaaaaagattgacaaaatttttaaaaggtgcaaaaatattttttaaa
agagaagatttaaatcatactggtgctcataaaattaataatgttataggacaagctatt
ttagcaaaaattatgaataaaaaaagaataatagcagaaacaggagcaggacaacatgga
ttagctacttcaacaatatgtgctaaatttggtattaaatgtactatatatatgggagaa
aatgatattaaaagacaatctgaaaatgttaaaaaaatgaaattattgggttctaaaatt
atatctgtaaaaacaggaacaaaaactttaaaagatgctttaaatgaagcaatgaaagat
tgaataaaaaatgtaaaaaacactttttatataataggaacaattgcaggacctcatcct
tatccaatgatagtaagagattttcaatcaattattggttatgaaagtattctacaaatt
tttgaaaacaaaattaatattcctaaatatataatagcatctataggaggtggctcaaat
tctattggaatattttattcttatataaaaaaaaataatattaaactaataggtgtagaa
gctgcaggtaaaggtttacatacattattaaattcttcttcattaaatttaggaaaatta
ggtgtattacatggtaataaaacatatttattacaaaataaaaattatcaaattttatct
acacattcaatatctgcaggattagattatccaggaataggcccagaacattctttatta
aaagatttaaatagaattgattatgaatttataattaataaagaagctttaaaatcattt
attattttttgtaaaatagaaggaattattccagctcttgaatcatgtcatgctattgct
tatgctatgaaattagcaaaaaatttatctaaaaacaaaattattttagtaaacctttca
ggtagaggagaaaaagatataaataatataaatttataa

DBGET integrated database retrieval system