KEGG   Zea mays (maize): 100280534Help
Entry
100280534         CDS       T01088                                 

Definition
delta DNA polymerase
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
zma  Zea mays (maize)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100280534
   00240 Pyrimidine metabolism
    100280534
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100280534
   03410 Base excision repair
    100280534
   03420 Nucleotide excision repair
    100280534
   03430 Mismatch repair
    100280534
   03440 Homologous recombination
    100280534
DNA repair and recombination proteins [BR:zma03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      100280534
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MTRGGGGDMKSFFRQQKTHAAAATTKPTGGVSKKAAAHHHKKAALATNVHPAPCTDPDHG
AGSRQQEEAEAEQRERAGREFDMDTRYGPCLGVTRAQRWRRAAALGLAPPPALLALCADE
QPCLWEGRV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggggcggcggaggcgacatgaagtccttcttccgtcagcagaagacgcacgcc
gccgccgccactaccaagcccactggcggcgtctccaagaaggcggcggcgcatcaccac
aagaaggccgcactcgccaccaacgtccacccggccccatgtaccgatcccgatcacggc
gccggcagccgccagcaggaggaggcggaggcggagcagcgggagagggcgggccgcgag
ttcgacatggacacgcgctacgggccatgcctcggcgtcacccgcgcccagcggtggcgc
cgcgccgccgcgctcggcctcgcaccgccgccggcgctcctcgccctctgcgccgacgaa
cagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system