KEGG   Zea mays (maize): 100280534Help
Entry
100280534         CDS       T01088                                 

Definition
delta DNA polymerase
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
zma  Zea mays (maize)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:zma00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:zma00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:zma03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:zma03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:zma03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:zma03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:zma03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 129 aa AA seqDB search
MTRGGGGDMKSFFRQQKTHAAAATTKPTGGVSKKAAAHHHKKAALATNVHPAPCTDPDHG
AGSRQQEEAEAEQRERAGREFDMDTRYGPCLGVTRAQRWRRAAALGLAPPPALLALCADE
QPCLWEGRV
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggggcggcggaggcgacatgaagtccttcttccgtcagcagaagacgcacgcc
gccgccgccactaccaagcccactggcggcgtctccaagaaggcggcggcgcatcaccac
aagaaggccgcactcgccaccaacgtccacccggccccatgtaccgatcccgatcacggc
gccggcagccgccagcaggaggaggcggaggcggagcagcgggagagggcgggccgcgag
ttcgacatggacacgcgctacgggccatgcctcggcgtcacccgcgcccagcggtggcgc
cgcgccgccgcgctcggcctcgcaccgccgccggcgctcctcgccctctgcgccgacgaa
cagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system