KEGG   Zea mays (maize): 100283397Help
Entry
100283397         CDS       T01088                                 

Gene name
GRMZM2G050570
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
zma  Zea mays (maize)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:zma00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100283397 (GRMZM2G050570)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100283397 (GRMZM2G050570)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100283397 (GRMZM2G050570)
Enzymes [BR:zma01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     100283397 (GRMZM2G050570)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
3
AA seq 527 aa AA seqDB search
MATFTAASSLSLLFSHPHSHSRQPSAQGPTASSHLHLHPRASRARCASSDTTATKHRRPA
EENIREEAARLRGPAQGFSAWYEPFPPAPGGDPNERYSLDEVVYRSSSGGLLDVRHDMEA
LARYPGSYWRDLFDSRVGRTAWPYGSGVWSKKEFVLPEIDSDHIVSLFEGNSNLFWAERL
GREHLGGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTS
AALSAYCAAAGIPAIVFLPADRISLQQLIQPIANGATVLSLDTDFDGCMRLIREVTAELP
IYLANSLNPLRLEGQKTAAIEILQQFNWQVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLV
DRVPRLVCAQAANANPLYRYYKSGWTEFEPQTAETTFASAIQIGDPVSVDRAVVALKATD
GIVEEATEEELMDATALADRTGMFACPHTGVALAALFKLQGQRIIGPNDRTVVVSTAHGL
KFTQSKIDYHDKNIKDMVCQYANPPISVKADFGSVMDVLQKNLNGKI
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccttcaccgcggcctcctccctctccctcctcttctcccacccgcactcccac
tcccgccaaccatccgcccaggggcccaccgccagctcccacctccacctgcatccgcgc
gccagccgcgcgcgctgcgcctcttccgacacgacggccacgaagcaccgccgcccagcg
gaggagaacatccgcgaggaggcggcgcggctccgaggcccggcccagggtttctctgcg
tggtacgagcccttcccgccggcgcccggcggcgacccgaacgagcgctactcgctggac
gaggtcgtctaccgctccagctcggggggcctcctcgacgtgcgccacgacatggaggcg
ctggcccgctacccggggtcctactggcgtgacctcttcgactcccgcgtcggccgcacc
gcctggccctacggctcgggcgtctggtccaagaaggagttcgtgctccccgagatcgac
tccgaccacatcgtctccctcttcgagggcaactccaacctcttctgggcggagcgcctc
ggccgcgagcacctcggcgggatgaacgacctctgggtcaagcactgtggcatctcccac
acgggctccttcaaggacctcggcatgacggtgctcgtcagccaggtgaaccgcctccgc
cgcgcgccgctctcgcgccccatcgccggtgtcggctgcgcgtccacgggagacacctcc
gccgcgctctcggcctactgcgcagccgcgggaatccccgccatcgtgttcctgccagcg
gaccgcatctcgctgcagcagctcatccagccgatcgccaacggcgccaccgtgctctct
ctagacactgattttgatggctgcatgcggctcattcgcgaggtcactgcagagctgcca
atctaccttgccaattcgctcaacccgctccgccttgaggggcagaagacagcggccatc
gagatattgcagcagttcaattggcaggtgccagattgggtcattgttccaggaggcaat
cttgggaatatctatgcattctacaaggggtttgagatgtgccgcgttcttggacttgtt
gatcgcgtgccacggcttgtctgcgcacaggctgcaaatgcaaatccattgtaccggtac
tacaagtcaggttggactgagtttgagccacaaactgccgagactacatttgcatctgcg
atacagattggtgatcctgtatctgttgaccgtgcggtggtcgcgctgaaggccactgac
ggtattgtggaggaggctacagaggaggagctaatggatgcaacggcgcttgctgaccgc
actgggatgtttgcttgcccacatactggggttgcacttgctgctttgtttaagcttcag
ggtcagcgtataattggccctaatgaccgcactgtggttgttagcacagctcatgggctg
aagttcacgcagtcaaagattgactaccatgacaaaaacatcaaagacatggtttgccag
tatgctaatccaccgatcagtgtgaaggctgactttggttctgtgatggatgttctccag
aaaaatctcaatggtaagatataa

DBGET integrated database retrieval system