KEGG   Zea mays (maize): 542030Help
Entry
542030            CDS       T01088                                 

Gene name
hag101, gcn5
Definition
histone acetyl transferase GNAT/MYST 101
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     542030 (hag101)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     542030 (hag101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
AA seq 515 aa AA seqDB search
MDGLVAPSPSHSGATSGGGASHRKRKLPPSSLSDATGDEDDDTTAPSSPSTAPSSPSRPS
SPSSSHSDDDDDDSLHTFNAARLDGAPSGGSASGRPPKPDSSSVSAAAAAAAAAVGGGPK
PEPGSANAGDGKEDTKGLFTDNLQTSGAYSAREEGLKREEDSGRLKFLCYSNDGVDEHMI
WLVGLKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYASQRFGEIAF
CAITADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKER
WQGYIKDYDGGILMECKIDPKLPYVDVATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKK
EAGIPRRLIKPEDIPGLREAGWTPDQLGHSKSRSSFSPDYNTYRQQLTTLMQTALKNLNE
HPDAWPFKEPVDSRDVPDYYDIIKDPIDLRTMLRRVDSEQYYVTLEMFVADMKRMFSNAR
TYNSPDTIYYKCATRLENFFSGRITVLLAQLSTKS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcgtggcgccgtcgccatcccactccggcgccacctccggcggcggggcc
tcccaccgcaagcggaagctcccgccgtcgtcgctctccgacgccaccggcgacgaggac
gacgacaccaccgctccgtcatccccctccacggccccatcctcgccctctcgcccgtca
tctccatcttcttcgcactccgacgatgacgacgacgactcgctccacacgttcaatgcc
gcgcgcctcgacggcgcgccgagtgggggctctgcgtccggccgtcctcctaagccggat
tcctcatcagtgtctgctgctgcggcggcagccgcggctgcggtgggtggaggacctaag
ccggagcccggctcggcgaacgccggcgacgggaaggaggacacaaaggggctgttcacg
gacaacctccagaccagcggcgcgtacagcgcccgtgaggagggcctcaagcgcgaggaa
gattcaggacggctgaagtttctctgttattctaatgacggcgttgatgaacacatgata
tggttggtagggttgaagaatatcttcgcccgacagcttcctaatatgcccaaagaatat
attgtacgccttgtcatggatagaactcacaagtcaatgatggttatcaggaacaatatt
gtcgtggggggcattacttatcgcccttatgcaagccagagatttggagaaatagcgttt
tgtgctatcacagctgatgagcaagttaaaggctatggaacaagattaatgaatcatttg
aaacaacatgcacgggatgctgatgggctcacacatttcttaacctatgctgataacaat
gctgttggctattttgtaaagcagggtttcacaaaggagatcacattggacaaagaaaga
tggcaagggtacattaaagattatgacggaggaatattgatggagtgtaaaattgaccca
aagctgccatatgttgatgtggcaacaatgattcgacgtcaaaggcaggccattgatgag
aagatcagagagctttctaactgccatattgtttattcaggaattgattttcaaaagaaa
gaagctggcattccaagaagactgataaagccagaagatatccctggtctcagggaagct
gggtggacgcctgatcaattggggcattctaaatcacgatcatcattctccccggactat
aatacttacaggcaacagcttactacccttatgcagacagcgctgaagaatctgaatgaa
catcctgatgcttggccattcaaagagcctgtggattcacgggatgttccagactattat
gatatcatcaaagatcctattgatttaagaacaatgttaagaagagtcgactcggaacaa
tattatgtgaccctagagatgtttgtagccgacatgaagagaatgttcagcaatgcaaga
acttacaattctccagatactatctattacaaatgtgcgacacggcttgaaaacttcttc
tcgggcagaattactgtactgcttgcacaactctcaaccaagagctag

DBGET integrated database retrieval system