KEGG   Zea mays (maize): 542030Help
Entry
542030            CDS       T01088                                 

Gene name
hag101, GNAT6, gcn5
Definition
(RefSeq) histone acetyl transferase GNAT/MYST 101
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
zma  Zea mays (maize)
Brite
Enzymes [BR:zma01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     542030 (hag101)
Transcription machinery [BR:zma03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     542030 (hag101)
Chromosome [BR:zma03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    542030 (hag101)
   HAT complexes
    PCAF complex
     542030 (hag101)
    STAGA complex
     542030 (hag101)
    TFTC complex
     542030 (hag101)
    SAGA complex
     542030 (hag101)
    SLIK complex
     542030 (hag101)
    ADA-HAT complex
     542030 (hag101)
    HAT-A2 complex
     542030 (hag101)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MaizeGDB: 
UniProt: 
Position
5
AA seq 515 aa AA seqDB search
MDGLVAPSPSHSGATSGGGASHRKRKLPPSSLSDATGDEDDDTTAPSSPSTAPSSPSRPS
SPSSSHSDDDDDDSLHTFNAARLDGAPSGGSASGRPPKPDSSSVSAAAAAAAAAVGGGPK
PEPGSANAGDGKEDTKGLFTDNLQTSGAYSAREEGLKREEDSGRLKFLCYSNDGVDEHMI
WLVGLKNIFARQLPNMPKEYIVRLVMDRTHKSMMVIRNNIVVGGITYRPYASQRFGEIAF
CAITADEQVKGYGTRLMNHLKQHARDADGLTHFLTYADNNAVGYFVKQGFTKEITLDKER
WQGYIKDYDGGILMECKIDPKLPYVDVATMIRRQRQAIDEKIRELSNCHIVYSGIDFQKK
EAGIPRRLIKPEDIPGLREAGWTPDQLGHSKSRSSFSPDYNTYRQQLTTLMQTALKNLNE
HPDAWPFKEPVDSRDVPDYYDIIKDPIDLRTMLRRVDSEQYYVTLEMFVADMKRMFSNAR
TYNSPDTIYYKCATRLENFFSGRITVLLAQLSTKS
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggacggcctcgtggcgccgtcgccatcccactccggcgccacctccggcggcggggcc
tcccaccgcaagcggaagctcccgccgtcgtcgctctccgacgccaccggcgacgaggac
gacgacaccaccgctccgtcatccccctccacggccccatcctcgccctctcgcccgtca
tctccatcttcttcgcactccgacgatgacgacgacgactcgctccacacgttcaatgcc
gcgcgcctcgacggcgcgccgagtgggggctctgcgtccggccgtcctcctaagccggat
tcctcatcagtgtctgctgctgcggcggcagccgcggctgcggtgggtggaggacctaag
ccggagcccggctcggcgaacgccggcgacgggaaggaggacacaaaggggctgttcacg
gacaacctccagaccagcggcgcgtacagcgcccgtgaggagggcctcaagcgcgaggaa
gattcaggacggctgaagtttctctgttattctaatgacggcgttgatgaacacatgata
tggttggtagggttgaagaatatcttcgcccgacagcttcctaatatgcccaaagaatat
attgtacgccttgtcatggatagaactcacaagtcaatgatggttatcaggaacaatatt
gtcgtggggggcattacttatcgcccttatgcaagccagagatttggagaaatagcgttt
tgtgctatcacagctgatgagcaagttaaaggctatggaacaagattaatgaatcatttg
aaacaacatgcacgggatgctgatgggctcacacatttcttaacctatgctgataacaat
gctgttggctattttgtaaagcagggtttcacaaaggagatcacattggacaaagaaaga
tggcaagggtacattaaagattatgacggaggaatattgatggagtgtaaaattgaccca
aagctgccatatgttgatgtggcaacaatgattcgacgtcaaaggcaggccattgatgag
aagatcagagagctttctaactgccatattgtttattcaggaattgattttcaaaagaaa
gaagctggcattccaagaagactgataaagccagaagatatccctggtctcagggaagct
gggtggacgcctgatcaattggggcattctaaatcacgatcatcattctccccggactat
aatacttacaggcaacagcttactacccttatgcagacagcgctgaagaatctgaatgaa
catcctgatgcttggccattcaaagagcctgtggattcacgggatgttccagactattat
gatatcatcaaagatcctattgatttaagaacaatgttaagaagagtcgactcggaacaa
tattatgtgaccctagagatgtttgtagccgacatgaagagaatgttcagcaatgcaaga
acttacaattctccagatactatctattacaaatgtgcgacacggcttgaaaacttcttc
tcgggcagaattactgtactgcttgcacaactctcaaccaagagctag

DBGET integrated database retrieval system