KEGG   Zygosaccharomyces rouxii: ZYRO0E08360gHelp
Entry
ZYRO0E08360g      CDS       T01118                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
zro  Zygosaccharomyces rouxii
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:zro00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    ZYRO0E08360g
Exosome [BR:zro04147]
 Exosomal proteins
  Proteins found in most exosomes
   ZYRO0E08360g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E:662545..667491
Genome map
AA seq 1648 aa AA seqDB search
MSDLPIEFTELADLTSLGISPQFLDFRSTTFESDHYVTIRETNDGVNSVAIVDLANNNNV
IRKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSFTLDEPVLFWKWLNEKTLG
LVTARSILISHVFDGNVGAKPQLLTIRHASLNNTQIINFVTNKNEDWFAVVGILQENGRI
AGKIQLYSKQRNISQAIDGHVAIFANILLDGNVNPVQVFVTGNRNVQTGAGELRIIEIEH
DNSLPVSYQKKTVDIFFPPDAVNDFPIAVKVSEKYGVVYLLTKYGFIHLYELETGTNLFV
NRITAESVFTAASYDNQNGICCINKKGQVLAVEISTSQIVSYILNKLSNVSLALTVASRG
GLPGADGLFQKQFESLLSQGDYQGAAKVAASSNQLRNQNTINRLKNVQAAPGAISPILLY
FSTLLDKGKLNRDETIELAKPVLQQDRKQLFEKWLKEDKLECSEPLGDIVKPFDTTLALA
CYLRAGSHAKVVSCLAELQQFDKITAYCQKTGFQPNFLVLISSLIRFSPDRAAEFAISLL
QNPETASQLEIEKIADLFFSQQHVQQGTSLLLDALKGDTPNQGHLQTRVLEVNLTHAPQV
ADAILGNNIFSHYDKPTIASLSEKAGLYQRALENYTDIKDIKRCIVHTNALPVDWLVAYF
GKLNVEQSLACLRTLMENNLQSNIQIVIQVATKFSDLIGSSVLIKLFEEYRATEGLYYYL
ASLVNLTEDKDVVYKYIECAAKLNQYKEIERIVKDNNVYDAEKVKNFLKNAELEDQIPLI
IVCDRFDFVHELVLYLYKTRNMKFIEAFVQQVNPSKTPQVVGALLDVDCDEDFIKGLLQS
VFGQVSIKELTEEVEKRNRLKLLLPFLEQTLAQGAQDQGVYNALAKIYIDSNNAPEKFLK
ENDQYNTLDVGHYCERRDPYLAYIAYEKGTNDEDLIRITNENSMYKYQARYLLKRSDSEL
WNTVLNSDNVHRQQLIEAVISVGIPELTDPEPVSLTVQAFMSNGLKIELIELLEKIILEP
STFSDNVALQGLLLLSAIKYEPSKVASYIEKLEKYDANEIAPLCISHGLTEEAFEIYEKH
EMPEKALKVLIEDVMNLDRAQTYVEKVNTPGLWSQLGTAQLDGLRIPSAIESYIKAEDPS
NYENVIEVAEKEGDYEELLPYLTMARKSLKEPKIDGSLILAYASLGKVHEIENLLSGPNV
ADLEDVGDRLMDIKNYKAAKLCYASVSNYSKLASTLVYLDDYQAAVDTARKASNIRVWKL
VNDACIDRKEFRLAQICGLNLIIHAEELGELVEKYESNGYFDQVISLFEAGLGLERAHMG
MFTELAILYSKYEPSKTYEHLKLFWSRINIPKVIRAVEEAHLWNELVFLYAHYDEWDNAA
LTMIDKSAKNLDHSYFKEVIVKVSNLEIYYKAINFYVTEHPSLLVDLLAVLTPRLDIPRT
VKLFAKSDNLPLIKPFLVNVLPKNNSVVNQACHDLMIEEEDYKALQDAVDSYDKFDQLAL
AARLESHELIFFKKIAALLYRRNKKWAKSLSILKEEKLWRDAIETAAISGDSKVVEDLLT
DFVETENKESFVALLYTAYHLVRYDFVLEISWLHNLGDLSKPYEISVQKEHTDAIKKLSD
ELVQKGSVSEGPADGQPLMLTNGAPGLF
NT seq 4947 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatctgcccattgaatttacagaactggcagatctaacgtcgttaggaatttcc
cctcaattcctcgactttagatcaacaacttttgaatcggatcattacgtgacaattaga
gagactaatgatggtgttaattccgttgcaattgtcgatttagctaataataacaatgtt
attcggaaaaatatgggtggtgactctgctattatgcatccatcccaaatggttatttca
gttagagccaacggtacaattgttcaaatctttaatttagagacgaaatcaaaattaaaa
tccttcacacttgatgaacctgtattgttttggaaatggttaaatgaaaagacacttggt
ttggttaccgccaggtcaattttgatttctcatgtttttgatggaaatgttggtgcaaaa
cctcagcttttaacgataaggcacgctagtttaaacaatactcaaattatcaactttgtt
actaataaaaatgaagattggtttgcagttgttggtattttacaagaaaatggtcgtatt
gctggtaagattcaattgtactctaagcaacgtaacatttctcaggctatcgatggtcac
gtggccatctttgccaatatcctattggatggtaacgtgaatccagtacaggttttcgtc
actggtaacagaaatgtccagactggtgctggtgaactaagaattattgaaattgaacat
gataattcattaccagttagttatcaaaagaaaactgtggatattttctttccaccagat
gcagttaacgatttccccattgcggttaaagtttctgaaaaatatggtgttgtttacttg
ttgaccaagtacgggttcatccatctatatgaattggaaaccggtactaaccttttcgtc
aacagaatcaccgcggaatccgttttcacagcagcttcttatgacaaccaaaatggtatc
tgttgtatcaataaaaagggtcaagttttagcggttgaaatatccacatctcaaatagta
tcttacattttgaacaaattgtccaatgtttcattagctttaacggttgcatccagaggt
ggattgccaggtgctgatggtttgttccagaagcaatttgaatcgctattgtcccaaggt
gattatcaaggtgccgctaaagttgctgcttcttcaaatcaattgagaaaccaaaatacc
attaacagattgaaaaacgttcaagcggcaccaggtgcaatttctcctattcttttgtat
ttttcaactcttttagataagggtaaattgaacagagatgagactatcgaattggcaaaa
cctgttttacaacaggacagaaagcagttgttcgaaaaatggttgaaagaggataagttg
gagtgttctgaaccattaggtgatattgttaaaccattcgatactactttggctctagct
tgttatttgagagctggttcacatgcgaaggttgtttcctgtttggctgaattgcaacaa
ttcgacaaaattactgcttactgtcaaaagaccggattccaacctaacttcttggtgttg
atttcttctttaattcgcttttctccagacagagccgctgaattcgcaatctccttgttg
caaaacccagagactgcatctcaattagaaattgagaaaatcgccgatttgttcttctct
caacaacatgtccaacagggtacttcgttgttgttggacgctttgaagggagacactcct
aaccaaggtcatttgcagactcgtgttttagaagtcaacttgacgcatgcacctcaagtt
gcagacgctattttgggtaataacatcttctctcattatgataagcctactattgcatct
ctatctgaaaaggcaggcttgtatcaaagagccttagaaaactatacggatatcaaggac
atcaagagatgtattgtacacaccaatgctttaccggtggattggttagtggcttacttc
ggtaagttgaatgtggaacaatccttggcttgtttgagaactttaatggaaaataatttg
caatcgaacattcaaatcgtcattcaagttgccaccaaattttccgacctaattggttcc
agcgttttaatcaaactatttgaagaatacagagccactgaaggtttatactactacttg
gcatcattggttaacttgactgaggacaaggatgtcgtctacaaatacattgaatgtgct
gccaaattgaatcagtacaaggagattgaaaggattgtcaaggataacaatgtctatgac
gccgaaaaggtaaagaactttttgaagaacgctgaattggaagatcaaatcccattgatc
attgtttgtgaccgtttcgactttgtccacgaattggtcttgtacttatacaagactcgt
aacatgaaattcattgaggcattcgtgcaacaagtaaatccatccaagacaccacaagtt
gttggtgctttgttggatgttgattgtgatgaagatttcatcaaaggtctattgcaatct
gtttttggccaagtttccattaaggaattgactgaagaagtcgagaaaagaaatagattg
aaattattgcttcctttcttagagcaaactttggcacaaggtgctcaggaccaaggtgtc
tacaatgctttggctaagatatacatcgattctaacaatgctcctgagaagttcttgaaa
gagaatgaccagtacaataccttggatgttggtcactactgcgaaagaagagacccatac
ttggcttacatcgcctatgaaaagggtaccaatgatgaggatttgattagaattaccaat
gaaaacagcatgtacaaataccaagctaggtacttgttgaagcgttcagattctgaattg
tggaatactgtgttgaattctgataacgttcacaggcagcaattgattgaagcggtcatt
tctgttggtattcctgaattgaccgaccctgaacctgtctctttgaccgttcaagctttc
atgagcaatgggttaaagatcgaattgatcgaattgttagaaaagatcattttagagcct
tcgactttcagcgacaacgtagccttacagggattgttgttattatcagccatcaaatat
gaaccttccaaggttgcttcttacattgaaaagttggaaaaatatgatgccaatgaaatt
gctccattgtgtatttcccacggtttaaccgaggaggccttcgaaatttatgaaaagcat
gaaatgccagaaaaggctttgaaggttttgattgaagacgtcatgaacttggacagagct
cagacctatgttgaaaaggtcaacacaccaggcctatggtctcaacttggtaccgcacag
ctggatggtctccgtattccaagtgccattgaatcctacatcaaggccgaggacccatcc
aactacgaaaacgtgattgaagttgccgagaaagagggtgattatgaggaattgttgcca
tatttgaccatggcaaggaaatccttgaaagaaccaaagattgacggttctttgattttg
gcttatgctagcttgggtaaggtccacgaaattgaaaacttgctttctggtccaaacgtt
gctgatctggaagatgttggtgacaggttgatggacatcaagaactacaaggctgctaag
ttatgttacgctagtgtttccaattactctaaattggcttctacattggtctatttagat
gattatcaagctgctgttgataccgccagaaaggcatccaatatcagagtttggaagttg
gttaacgatgcctgtattgaccgaaaagaatttagacttgctcaaatttgtggtctgaat
ttgatcattcatgctgaggagttaggtgagcttgttgagaagtacgaatccaacggttac
ttcgaccaagtcatatctttgtttgaagctggtcttggtttggaaagagcccatatgggt
atgttcaccgaattggccattttgtattcgaagtacgaaccatctaagacttacgagcat
ttgaaattgttctggtctagaatcaatattccaaaggtcatcagagctgttgaagaggca
cacttgtggaatgagttggtatttttgtatgctcattacgatgaatgggacaatgccgcc
ttgactatgattgataaatctgcgaagaacttggatcactcctatttcaaggaggttatt
gtcaaagtttccaacttggagatttattacaaggcgatcaacttttacgtcactgaacat
ccatctcttcttgtcgatttgttggcggttttaactccaagattggatattccaagaact
gtcaagttgtttgccaaatctgacaacttaccattgatcaagcctttcttggtcaacgtt
ttgcctaagaataactctgtggtaaatcaagcttgccacgatttgatgatcgaagaagag
gattacaaagcgttgcaagatgctgttgattcttacgataaattcgatcaactagctcta
gctgctcgtttggaaagtcatgaattaattttcttcaagaagattgctgcattgttgtac
cgtaggaacaaaaaatgggctaagagtttgtctattttgaaagaagaaaaactttggagg
gatgctattgaaactgctgccatttctggtgacagcaaggtcgttgaagatttgctgacc
gactttgttgaaactgaaaacaaggaatcctttgtggctctattgtacacggcatatcac
ctggtcagatacgatttcgttttggagatatcctggttgcataatttgggtgacttgagt
aagccttatgaaatttctgttcagaaggaacatactgatgccatcaagaagttgtccgat
gaactggttcagaagggttctgtgtctgagggtcctgctgatggtcaacctttgatgttg
actaacggtgctccaggtctcttttaa

DBGET integrated database retrieval system