KEGG   Zymoseptoria tritici: MYCGRDRAFT_51809Help
Entry
MYCGRDRAFT_51809  CDS       T02285                                 

Gene name
HDA2402
Definition
histone deacetylase
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ztr  Zymoseptoria tritici
Brite
Enzymes [BR:ztr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     MYCGRDRAFT_51809 (HDA2402)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MKPHRIRMAHSLIMNYGLYKKLEIYRAKPASKYEMTQFHTDEYVDFLQRVTPDNMDGFVK
EQGRYNVGDDCPVFDGLFEFCGISAGGSMEGAARLNRGKCDVAVNWAGGLHHAKKSEASG
FCYINDIVLGILELLRFHPRVLYIDIDVHHGDGVEEAFYSTDRVMTVSFHKYGEYFPGTG
ELRDIGVGAGKNYSVNFPLRDGIDDKSYKGIFEPTIGWVMEYYKPTAVVLQCGGDSLSGD
RLGCFNLSMRGHANCVNFVKSFGLPTLILGGGGYTMRNVARTWAFETGQLVGVEMGSDLP
FTDYYEYYSPDFELDVKPSNMDNANSPEYLEKIKNQVLENLKRTTQHAPSVQMQDVPREP
LGMHNSGPDGEAETFEEQEDRLDDEEADAESGKDRRYTQRLWDKKIERDDEMDESDDEEL
AEANGVKKQPGAQRRRGIMDYNNPHAPADRSGANTPVDDAQSLNGDAQQEDEAMQLDGQP
QPTSAPAEEVVAQETSKSRSPLAQAEPA
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgcatcgcattcggatggcccactcgttgatcatgaactacggactgtacaag
aagctggaaatctaccgtgcgaagccagcatccaagtacgaaatgacacaattccacacc
gacgagtatgtcgatttcctgcaacgcgtaacaccggacaatatggacggtttcgtgaaa
gagcagggccgctataacgtgggagacgattgtcctgttttcgacggcctgtttgagttc
tgtggaatcagtgcgggaggcagcatggagggagcggccagactgaacagagggaagtgt
gatgtggctgtcaactgggctggtggtctgcatcatgcaaagaagagcgaggcttctggc
ttctgctacatcaatgacatcgtcctgggcattctcgaactcctccgctttcaccctcgt
gttctctacatcgacatcgacgtccaccacggtgatggcgtcgaagaggctttctactcc
accgaccgcgtcatgacagtctccttccacaaatacggcgaatacttcccaggaactgga
gagctgcgcgatattggtgttggcgcgggcaagaactattcagtcaacttccctctccgc
gacggcattgatgacaagagctacaagggcatctttgagccaaccattggctgggttatg
gaatactacaagccaactgctgtcgtcctccaatgcggtggtgactccctatccggagac
cgacttggctgcttcaacctcagtatgcgcggacacgccaactgcgtcaacttcgtcaag
tcatttggccttccaactctcatcctcggtggcggtggctacaccatgcgcaacgtcgca
cggacttgggcattcgagacgggtcaacttgtgggcgtggaaatgggttccgatcttccc
ttcaccgactactacgaatactactcgccagacttcgaacttgatgtcaagcctagcaac
atggacaacgcaaactctcccgaatacctcgagaagatcaaaaaccaagttctggagaat
ctcaaacgcaccacgcagcacgctccctcagttcaaatgcaagacgtccctcgcgagcct
ctcggcatgcacaactccggcccagacggcgaagcggagactttcgaggagcaagaagat
cgtctcgacgacgaggaggcagacgcggagtcgggcaaggatcgtaggtacacgcaacgt
ttgtgggataagaagatcgagcgtgatgatgagatggacgagagcgacgacgaggagctc
gccgaagcaaacggtgtgaagaagcagccgggagcacagaggcgaagaggaatcatggac
tacaacaacccacacgccccagcggatcgcagcggcgctaatacccctgtggacgacgca
caaagcttgaatggagatgcacaacaagaggacgaggcgatgcagcttgatggccagcca
cagccaacgagtgctcctgcggaagaagtcgtggcgcaagagacttcgaagagcagaagt
ccgctggcccaagctgagccggcc

DBGET integrated database retrieval system