KEGG   Apteryx australis mantelli (brown kiwi): 106492025Help
Entry
106492025         CDS       T04298                                 

Gene name
PLK4
Definition
(RefSeq) polo like kinase 4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
aam  Apteryx australis mantelli (brown kiwi)
Pathway
aam04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aam00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106492025 (PLK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:aam01001]
    106492025 (PLK4)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aam03036]
    106492025 (PLK4)
Enzymes [BR:aam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     106492025 (PLK4)
Protein kinases [BR:aam01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   106492025 (PLK4)
Chromosome and associated proteins [BR:aam03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106492025 (PLK4)
   Centrosome duplication proteins
    Regulators of centriole replication
     106492025 (PLK4)
  Sister chromatid separation proteins
   Polo kinases
    106492025 (PLK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Plk4_PB1 Pkinase_Tyr Plk4_PB2 POLO_box Pkinase_fungal Kinase-like Haspin_kinase Kdo TraA
Motif
Other DBs
NCBI-GeneID: 106492025
NCBI-ProteinID: XP_013807182
Position
Un
AA seq 882 aa AA seqDB search
MIDKKAMHKVGMVQRVQNEVKIHCQLKHPSILELYNYFEDSNYVYLILEMCHNGEMSRYI
KNRKKPFSEEEARHFLHQIITGMLYLHSHGILHRDLTLSNLLLTNNMNVKIADFGLATQL
KMPHEKHYTMCGTPNYISPEIATRSPHGLESDVWSLGCMFYTLLIGKPPFDTDTVKNTLN
KVVLADYEMPAFLSREAQDLIHKLLRKNPADRLSLSSVLDHPFMSRCNSARSKDLGTSED
SMDSGNATISTTFTGSSSISTSGCLKEKKKLLVGQPLPNKITFFPKNKNSSNSSSIDGSS
SCNQWGAQGKEPGLPGRGRAMQLVEERPHSRYLRRAHSSDRSGTSHSQTGGISNVAERCH
SMELLSKPRVGTRENTECFSPVNSYADMGEIFKEKTSSSSGSFEGQMSPPVKDQPHSNYL
CPMKPHVGLLAQKSQTETMQQWLGSMQTNVQLRPPADIIGNGNAHGGFRYHQGVQQDASR
NAWNTLKDIRSPDASLDCPHSINQGNPKKYTSGLLCKSEKIHPSSACGLQPTSEQNQAWG
KEQPVHQKPTLRSIVSPLSAHRLKPIRQKTKNAVVSILDNGEVCMEFLKEHHSQEFVKEV
LRISCDGNVIAVYHPNEGRGFLLDDRPPAPPEDICMYNFDNLPEKYWKKYQYAAKFVQLV
RTKTPKVTFYTRYAKCMLMENLPTADVEVCFYDGAKIHKTAGITRVIEKSGKSFTLKGES
EPSLKKEIQVYMDHANEGHRICLALESAVLEEEKRSESVPFFPIIVGRKPGNTESPQALA
PPSLDDANCTKEVMSLDGNIAASSTPVQTPNIIPLTSGAVWVQFNDGSQLVAQAGVSSIT
YTSPDGQTTRYGENDKLPEYIKEKLHCLSSILVMFTNPAGSH
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgatagataaaaaagccatgcacaaagttggaatggtacagagggttcaaaatgaggtc
aaaatacattgccagctaaagcatccatctatacttgagctttataactactttgaagat
agcaactatgtgtacttgatacttgagatgtgtcacaatggtgaaatgagcagatatata
aagaacagaaagaaacccttttcagaagaagaagcccgacacttcttgcatcagattatc
acgggtatgctgtatcttcattctcatggaatattgcatcgggacctcaccctttccaac
ctcttactcaccaataatatgaatgtcaaaattgctgattttggactagcaactcagttg
aaaatgcctcatgaaaagcattatacaatgtgtggaactcctaattacatttctccagag
atagccacaaggagtccacatgggcttgaatctgatgtgtggtctttgggctgtatgttt
tacactcttctgattggaaagccaccttttgacactgacacggtcaagaacacgctgaat
aaagtagtattagcagattatgaaatgccagcctttttgtcaagagaggcacaagacctt
atacataaattactccgaaaaaatccagcagatcgtttgagtctttcttctgtgttggat
catccttttatgtcccggtgcaactctgcacggagtaaagatttgggaacttcagaggat
tccatggacagtggaaatgctacaatctctaccacttttacaggctcttctagcatcagt
accagtggttgcttgaaggaaaagaagaagttattagttggacagccactcccaaataaa
attactttttttcctaaaaataagaattctagtaactcttcatccatagatggaagcagt
tcttgtaatcagtggggagctcagggaaaagaacctggcctacctggcaggggaagagcc
atgcagcttgttgaagagaggccacattcacgctatctccgaagagcccattcttctgat
aggtctggcacatcccatagtcagactggaggaatatcaaatgttgcagagagatgtcac
tctatggaactgctttccaagcctagagtaggaacaagggaaaacacagaatgcttttca
cctgtaaacagctatgctgatatgggagaaatatttaaggagaagacttcgagtagttct
ggttcttttgaaggacaaatgtctccacctgtgaaagatcaaccacactcaaattatctc
tgcccaatgaagccccatgttggtttattagcgcagaagtcccagactgaaacaatgcag
cagtggcttggaagcatgcaaacaaatgttcagctgagaccacctgcagacataattggc
aatggtaatgcacatggaggttttcggtatcatcagggtgtacagcaagatgcatcaaga
aatgcatggaacaccttaaaagatataaggagtcctgatgcatcccttgactgcccacac
tctataaaccagggaaacccaaagaaatatacctctggacttctctgcaaatctgagaag
attcatccatcttctgcctgtggtcttcagccaacttcagaacaaaaccaagcctggggc
aaagaacaaccagtgcatcagaaacctacactgcgaagcattgtatcccctctcagtgct
cacaggctaaaaccgatcaggcaaaaaacaaaaaatgcagtggtgagcattctagataat
ggggaagtatgtatggaatttctaaaagaacaccattcacaagaatttgtgaaagaagtt
ctcagaatatcttgtgatggaaatgtgattgcagtttatcacccaaatgaaggaagaggc
ttccttcttgatgacagacctcctgctcctcctgaagacatctgtatgtataactttgac
aacttgccagaaaagtactggaaaaaataccagtatgcagccaagtttgtacagttggtg
agaacaaaaacccccaaagttactttctatacaagatatgccaagtgcatgttgatggaa
aatttacccactgcagatgttgaagtttgtttttatgatggagcaaagatacacaagaca
gctggtataactcgtgtgattgaaaaatcaggaaaatccttcactttgaaaggagaaagt
gaaccaagtttgaagaaggaaatacaagtctatatggatcatgcaaatgagggacatcgt
atatgccttgcattggaatctgctgttctggaggaagaaaaaaggagtgaaagtgtccca
ttttttccaataattgttggaagaaaacctggcaatactgaatcaccacaagctctagca
cctccatcattagacgatgcaaactgtacaaaagaagttatgtcactggatggaaatata
gctgccagttctactccagttcaaactccaaacattattcctctgaccagtggagcagta
tgggttcagtttaatgatggatcccaactggtagcacaagcaggtgtttcttctatcaca
tacacatctccagatggccagacaaccaggtatggagaaaatgataagttgccagagtac
atcaaagagaagctgcactgtctgtcttctattcttgtgatgtttaccaatccagctggt
tcccattaa

DBGET integrated database retrieval system