KEGG   Paracidovorax citrulli: Aave_0532
Entry
Aave_0532         CDS       T00451                                 
Name
(GenBank) PilL protein
Organism
aav  Paracidovorax citrulli
SSDB
Other DBs
NCBI-ProteinID: ABM31137
UniProt: A1TJJ9
Position
complement(575379..575948)
AA seq 189 aa
MQPHPSPAPRRWGFAPVAAAVASVLLGGCASAPPAYEAAAPSPAPTASAPAGIDADRPSP
VPVTRQGRYTLVELGAEAGQRDLLMQVINVTQPSAEGSTVQDGLQYLLRQSGYRLCPPDA
DSSTLYALPLPAAHVRLGPITLRDALQTMAGDAWALSVDDTTRLVCFHRSGASAAAIEPA
WLPKEKQPW
NT seq 570 nt   +upstreamnt  +downstreamnt
atgcagccacacccctcacccgccccccgccgctggggattcgccccggtggccgccgcg
gtcgcatcagtcctcctgggcggatgcgcaagcgcaccacctgcctacgaggccgccgcc
cccagtccagcgcccacggcgtccgcacccgccgggattgacgcggaccggccttcgcca
gttccggtcacacggcagggccgctacaccctggtcgagctcggcgccgaggctggtcag
cgcgatctgttgatgcaggtcataaacgtcacgcagccatcggccgaagggtccacggtc
caggacggcctgcagtacctgctgcggcagtcgggctaccggctgtgcccgcccgacgcg
gacagcagcaccctgtatgccctgccgctgcccgcggcacatgtgcgtctcggccccatc
acgctgcgcgacgcgctccagacgatggccggcgacgcctgggcgctctcggtggacgac
acgacgcgcttggtctgctttcaccgctccggcgccagcgccgcggcgatcgagccggcc
tggcttccgaaggagaaacagccatggtga

DBGET integrated database retrieval system