KEGG   Acinetobacter baumannii BJAB0868: BJAB0868_01416Help
Entry
BJAB0868_01416    CDS       T02728                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
abaj  Acinetobacter baumannii BJAB0868
Pathway
abaj03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:abaj00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    BJAB0868_01416
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:abaj02044]
    BJAB0868_01416
Secretion system [BR:abaj02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   BJAB0868_01416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IcmF-related ImcF-related_N IcmF_C MMR_HSR1 DUF4381
Motif
Other DBs
NCBI-ProteinID: AGQ09965
Position
1498305..1502129
Genome map
AA seq 1274 aa AA seqDB search
MHTILGYLWQYITNPKAIIALSLFVALMSSYTSIPRHIFWALASAYALGLIAYGIYWLIQ
RKKHAVQGEELAQAIEKDTQAEYGKNKDKEELQLISQQMKESIQLIRKSKLGDKKGNAAL
YELPWYMVIGNPAAGKSSAIYNSGLKFPFEETHQKMVSAGLSGTRNCDWFFSTEGILLDT
AGRYSVYSEDHSEWLGFLNILKKNRSKAPVNGLILIVSIAELVSQSPEHSLKLAKNLRAR
IQDLTERLEVVVPVYLVFSKMDLIAGFTEFFEFYEAQEYNQAWGATLPYEQNSSHNAVDL
FEKHYNILYDGLKGVSSTHLSRRHSQNISPSVMTFPLEFKTLKPALKSFIATLFEDNPYQ
FQPVFRGFYFTSALQEGVIESPMTEQIAQEFQLSQIAQSEVKDQLKTTPNHGYFLKGLFS
DVILKDKDLVKQHVNTSKKRQRYIAFIGALAGVSIILGVWVWSYRNNQQLIAEVQADLNK
VVQLEKSSGQQLSTQLEALLILQRRLQQLDEFDENRPLKFSFGLYQGNELREKLKAEYLK
GVKQIVLIPTQQNIAQYLQRVKNNEATLKANHTNVEIKQTAQTQQYLEPSDTNPQDAYNA
LKAYLMMSNPQYMDASHLSDQVTRFWRSWLDANKGQMPRADMIQEAEQILSYAMTLANDK
QFPILDADSQLVDQTRQVLLSVIRGMPARDRVYNEIKMRAAVRFPALTVNQIVGDANKNI
VLGSYALPGVFTQKAWNEYVEKAIEEAADKPTDTKDWVLNSRQSDDLTFSGSPEQIRKQL
TALYKQEYIAEWRKFLSGIHYAKATQFAQQVKNIDVLGEPQNSPIRMLIERVAIETNWDN
PVVQAELAAPQKGFIAWFKRKVLNHDDKQLANQAVTNAQGPISQEYQMFYQLVRKRDDQQ
GKSLLDEYMTNLALVRSKFNELKNAGEIGPNAMTLVKQTLNEQTSVFNQTQKIVDEKMAV
GFSEIDQQLLQKLVVSPLTQAFESLITPTQDEINKLWVMQAYQPFTANLAKKYPFNSSAS
LQATSSEIGQILGENGSISRFVKESLDPFVIRRGYTLTSKTWKDLGISLNPQFVMNFQRY
VAPTNGMATGELNSQAPAAPATNQSNFQFYPIQNPQLLSYTVDIDGQRMTYENGVQQWVN
FIWPNQGSIPGARITAVDLQGQTHTIFDEPGEYGINRLIDSAQRKEQNGGFEMLWRSKTD
PSLFVKMNFRLISSNSGSIGSSRGYSGMQLVDKVTADKAARVVSAQQAPAQAAAPAKTEN
PVSALAQPAAGVKP
NT seq 3825 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaattttaggctacttgtggcagtacatcacgaatcctaaagcaattatcgcc
ttgtcattgttcgtggcattgatgtcttcctatacttcaattcctcgccatatattttgg
gctttagcatctgcatatgctttagggctcatcgcttatggaatttattggctaattcag
cgtaaaaagcatgctgttcaaggtgaagagcttgcacaagcgattgaaaaggatacccaa
gcagagtacggcaaaaataaagataaagaagagctgcaacttattagccaacaaatgaaa
gaatctattcaattgattcgtaagtcaaagttaggcgataaaaaggggaacgcagcacta
tatgagttgccatggtatatggtcattggtaacccagctgctggtaaaagttctgcgatc
tataattctggtttaaagtttccttttgaagaaacccatcaaaaaatggtttcggctggt
ttaagcggtacgcgtaattgtgactggtttttttcgactgagggtattttactcgacacc
gctggacgttattcggtctatagcgaagaccactctgaatggttaggctttttaaatatc
ttaaagaagaaccgttctaaggctccagtaaatggtttaattcttattgttagtattgct
gagcttgttagtcagagtcctgaacactcattaaagcttgcgaaaaatttacgcgctcgt
attcaggatttaaccgaacgtttagaagtggttgtacccgtatatctagtcttttcaaaa
atggatttgatcgcgggttttaccgaatttttcgaattctatgaagcacaagaatataat
caggcgtggggcgcaacactaccatatgagcaaaactcttctcataatgctgtagatctt
tttgagaaacactacaatattctttatgacggtttaaaaggggtcagttcaactcatctt
agccgtcgacattctcaaaatatctcacctagtgtgatgactttcccattagaatttaag
acattaaaacctgcattaaaaagttttattgcgacattgtttgaagataacccttaccag
ttccaaccagttttccgtgggttttatttcacaagtgctttgcaagaaggcgtaatagaa
agtccaatgactgagcaaattgcacaggaattccagctttcccaaattgctcaaagtgaa
gtaaaagatcagctaaaaacaacgcctaaccatggttatttcttaaaaggcttgttttca
gatgtcattttaaaagataaagatctggttaaacagcatgtcaatacaagcaaaaagcgt
cagcgttatattgcatttattggtgctttagcaggcgtatccattattctcggtgtgtgg
gtttggtcatatcgtaataatcaacaacttattgccgaagttcaagctgatttgaataaa
gttgttcaattggaaaagagttcaggtcaacaattgtcgactcaattagaggccttactt
atcttgcaaagacgtctacaacagttagacgaatttgatgaaaatagaccactaaaattt
agttttggtttatatcaaggtaatgagctacgtgaaaaattaaaagctgaatatttaaaa
ggtgttaagcaaattgttttgatacctacacagcaaaatattgctcagtatttgcaacgt
gtaaaaaataacgaagcaactttaaaagcaaatcataccaatgttgagatcaagcaaact
gctcaaactcagcaatatttagagccttcggataccaaccctcaagatgcttataatgct
ttaaaagcatatttaatgatgagcaatccacagtatatggatgcaagtcacttaagtgat
caggtaacgcgtttctggcgttcttggcttgatgccaataaagggcagatgccacgtgca
gatatgatccaagaagctgagcagatcttatcttatgcaatgacattggcaaatgataaa
caattcccgatcttggatgctgactctcaactcgtggatcagacacgtcaagtattgctc
tctgttattagaggtatgccagcacgtgaccgtgtttataatgaaattaaaatgcgtgct
gctgtgcgctttccagctttaactgtaaaccagattgtaggtgacgcaaataaaaatatt
gtattgggtagttatgcattaccaggggtatttactcaaaaagcttggaacgagtatgta
gaaaaagcaattgaggaagcagcagacaaacctacggatactaaagactgggtgcttaat
agccgtcaatctgatgatttaactttctcaggtagtccagagcaaatcagaaagcagctt
actgcattgtataaacaagaatatattgcagagtggagaaaattcttaagtggcattcac
tatgcaaaagcaactcagtttgctcagcaagttaaaaatattgatgtattgggcgaacca
caaaattcaccaattcgcatgcttattgaacgcgtagccattgaaacaaactgggataat
ccggttgttcaagcagagttagcagcgcctcaaaaaggatttattgcatggtttaaacgt
aaggttttaaaccatgatgataaacaattagcaaatcaggctgtaacgaatgctcaaggg
cctatttctcaagaatatcaaatgttctatcaattggttcgtaaacgtgatgatcagcaa
ggtaaatctttgcttgatgaatatatgacgaatcttgccttagtacgtagtaagtttaat
gaacttaagaatgcgggtgagatcggaccgaatgcgatgacattggttaagcaaacttta
aatgagcagacatcggtatttaaccagactcaaaaaattgtagatgaaaagatggcggtt
ggtttcagtgaaattgatcagcaacttctacaaaaattagtggtgagtccacttacccaa
gcctttgaaagtttaattacacctactcaagatgaaattaataagctatgggtaatgcaa
gcctatcaaccatttactgcaaatcttgctaagaaatatccatttaactcatcagcttct
ttacaagcaacaagtagtgaaattggacaaattcttggtgagaacggcagtatttcccgt
tttgttaaagagagtttagacccgtttgttatccgccgcggttataccttaacctccaaa
acatggaaagatttggggattagtttaaacccacaatttgttatgaacttccaacgctat
gttgcacctacaaatggaatggcaacaggtgagttaaatagccaagcaccagctgctccg
gcaactaatcagtctaacttccagttctacccaattcaaaacccgcagttactttcatat
accgttgatattgatggtcagcgtatgacttatgaaaatggggtgcagcaatgggttaac
tttatttggccaaatcaaggcagtattccgggtgctcgtattacggctgtagatttacaa
ggtcaaacacataccatttttgatgaaccaggcgaatacgggattaaccgtttaatcgat
agtgcacagcgtaaagagcaaaacggtggttttgaaatgctttggcgcagtaagacagat
ccatcactctttgtgaaaatgaacttccgtcttattagtagtaattcaggaagtatcggt
tcaagccgtggctactctggtatgcaactggttgacaaagtaactgcggataaggctgct
cgcgttgtatccgcacagcaagcaccagctcaggcagctgctcctgccaaaactgaaaat
ccagtttctgcactagcacaacctgctgcgggagttaagccatga

DBGET integrated database retrieval system