KEGG   Acidovorax carolinensis P3: CBP35_13105
Entry
CBP35_13105       CDS       T04998                                 

Definition
(GenBank) aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
acis  Acidovorax carolinensis P3
Pathway
acis00626  Naphthalene degradation
acis01100  Metabolic pathways
acis01120  Microbial metabolism in diverse environments
acis01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:acis00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    CBP35_13105
Enzymes [BR:acis01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     CBP35_13105
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: ART55695
UniProt: A0A240UA97
Position
complement(2839944..2840942)
AA seq 332 aa
MAKSGLLNASDIHGVWSILPTPSKPDASDWRATNTVDLDETARAVEGLIAAGANGILSMG
TLGECESLTWEEKKVFMQTIVETARGRVPVFVGTTTLNTRDTIEQTRYAHSIGADGTMLG
IPMWCNPCVDMAVQYYKDVAEAVPEMNIAIYANTEAFKFDFPRAFWARVSEIRQVVAAKY
IGIEFLLQDLHLTKHRMKLLPLDYQYYAAARMDDFVDAFWSSGTVCGPLVSTTLRDKVIA
ARRTKDWTDAHAFQGRLVKTAAPFPEDSFKTFSIYNVALEKGRIDAAGWMNAGPVRPPYN
DICPASYLDSWKASGQRWAELHKQLETESSGK
NT seq 999 nt   +upstreamnt  +downstreamnt
atggctaagtcaggactgttgaatgcatcggatattcatggagtatggtcaattcttccg
acaccatccaaaccggatgcgagtgactggcgtgcgactaacaccgttgatctggatgag
actgcccgcgccgttgaaggccttatcgcggctggcgcgaacgggattctgagcatgggt
actttgggtgagtgtgaatcgctaacctgggaggaaaagaaagtcttcatgcaaaccatc
gtggagaccgcgagaggaagggttccagtgttcgttggcaccacaacgcttaatacccgc
gacacgatcgagcagacaaggtacgcccactccattggggccgacggaacaatgttggga
ataccaatgtggtgcaatccctgcgttgatatggctgttcagtactacaaagatgtcgcc
gaagctgttccagagatgaatatcgctatctacgcgaataccgaggctttcaaatttgat
tttccccgcgcgttctgggctcgggtttcagagattcggcaagtcgttgcagcgaaatat
atcggtatcgagttcctgctgcaggatctacatctgaccaagcaccgcatgaagctgctg
ccgctcgactaccaatactatgctgcggcacgtatggatgacttcgttgatgccttctgg
tccagcggtaccgtgtgcgggccattggtttcgacgacgcttcgcgacaaggtcatcgca
gctcggcgaaccaaagactggaccgatgcccacgcatttcagggtcgacttgtgaaaaca
gctgcgccatttcccgaagatagcttcaagaccttttctatttacaacgttgcgctggaa
aaaggccgaatcgatgctgcaggctggatgaacgccggccccgttcgcccaccttataac
gacatctgcccagccagctatcttgactcctggaaagcctcagggcaacggtgggccgaa
ttgcacaagcaacttgaaacggaatcttcggggaaatag

DBGET integrated database retrieval system