KEGG   Anolis carolinensis (green anole): 100552857
Entry
100552857         CDS       T01608                                 

Gene name
fezf1
Definition
(RefSeq) FEZ family zinc finger 1
Organism
acs  Anolis carolinensis (green anole)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 zf-C2H2_jaz zf-Di19 Zn-ribbon_8 zf-Sec23_Sec24 zf-AN1 MCM_OB
Other DBs
NCBI-GeneID: 100552857
NCBI-ProteinID: XP_003221377
Ensembl: ENSACAG00000006695
UniProt: G1KFL9
Position
5
AA seq 426 aa
MESSSSRPLPTGKSLLSGASSSSSSSKALAFSIERIMARTAPEPKARPLLPPFLPKAGEK
APPTGLGLGSSLPCMLPFVPLAYKPPGEPPPASKAELPPHFKLVRPRVVTHSSFHALGAL
GYFGRAAEIPPPPPPPPPPPPPPSSLNLHPVASYFLGSSLQSHKASLAERNKLQALPGPA
SAAPPGFKELAHAHFHSAAAAAAAAAHLLAAEKLPFKGAVAAEFSRASPGAKPKAFTCEV
CGKVFNAHYNLTRHMPVHTGARPFVCKVCGKGFRQASTLCRHKIIHTQEKPHKCSQCGKA
FNRSSTLNTHTRIHAGYKPFVCEFCGKGFHQKGNYKNHKLTHSGEKQFKCNICNKAFHQV
YNLTFHMHTHNDKKPFTCPTCGKGFCRNFDLKKHVRKLHDSNGGTPSLALPRPPTAESEL
PPLPHS
NT seq 1281 nt   +upstreamnt  +downstreamnt
atggagagcagcagcagccggccgcttccgacgggcaagagcctcctaagcggagcctca
tcgtcgtcgtcgtcctctaaggcgctggcgttctccatcgagcgcatcatggcccgcacg
gcgccggagcccaaagcgcgcccgctcttgcctccgttcctgcccaaagcgggcgagaag
gcgcccccgacggggctcggcttgggctcctccctcccctgcatgctccccttcgtgccc
ttggcgtacaagccccccggggagccgccgcccgcctccaaagccgagctgcccccacac
ttcaagttggtccgcccgcgcgtggtcacccactcttccttccacgccttgggcgccttg
ggctacttcggacgtgccgccgagattccaccgccgcctcctcctccgccgccgcctcct
cctcctccgtcgagtctcaacctccacccggtggcgtcctacttcctgggctcgtcgttg
cagagccacaaggcgtccttggccgaaaggaacaagctccaagctctgccgggacctgcc
tccgccgcgccgccgggcttcaaggagttggcgcatgctcacttccacagcgccgccgct
gccgccgccgccgccgcgcacctcttggccgcggagaagctgcccttcaagggcgccgtg
gccgcggagttcagccgcgcttctcccggcgccaagcccaaggccttcacctgcgaggtc
tgcggcaaggtgttcaacgcgcattacaacctgacgcgccacatgcccgtccacacgggc
gcccgacccttcgtctgcaaagtctgcgggaagggcttccgccaggctagcactctctgc
cggcacaagatcatccacacccaggagaagccccacaagtgcagccagtgcggcaaagcc
ttcaaccggagctccaccttgaacacccacacgaggatccacgccgggtacaagcctttc
gtctgcgagttttgcgggaagggcttccaccaaaaagggaactacaagaatcacaagctg
acccacagtggggagaagcagttcaagtgcaatatctgcaacaaggccttccaccaagtg
tacaacctgaccttccacatgcacacccacaatgacaagaagcccttcacctgccccacc
tgtggcaaaggcttctgcaggaactttgacctcaaaaagcatgtccgcaaactccatgac
agcaatggtggcaccccctctttggccctgcctcgaccccccactgccgagtcagagttg
cctccgcttccccactcatga

DBGET integrated database retrieval system