KEGG   Anolis carolinensis (green anole): 100565578
Entry
100565578         CDS       T01608                                 

Gene name
ahrr
Definition
(RefSeq) aryl-hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:acs03000]
    100565578 (ahrr)
Transcription factors [BR:acs03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    100565578 (ahrr)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_11 PAS_4
Other DBs
NCBI-GeneID: 100565578
NCBI-ProteinID: XP_016849946
Position
6
AA seq 715 aa
MIPPGECLYAGRKRRKPIQKQRPTSGTGKTNPSKRHRDRLNAELDHLASLLPFPPDIIAK
LDKLSVLRLSVSYLRVKSFFQAVQEKQLRKHANHGMKDVGVLKEPVISEGGLLLESLSGF
ALVVSGDGMIFYASPTIVDYLGFHQTDVMHQNIYDYIHVDDRLDFCRQLHWAMDPPKLVS
GDHTHRETGEEFILSKMYTEQESANTTTDFSSFLTRCFTCRIRCLLDSTSGFLTMHFQGK
LKFIFGQKKKSSSGAILPPQLSLFCIVVPLLLPSVTDMKLKSFFVKAKCRSDHAASANTN
SKAHSGQCLADFHRRNSFQEGECNRENGISLMRFQANKDHWFWVQASTHVQCRNGSSECT
IALQQAPKEEKIQKIPNIISSIKGNREQLGQMKHHTWSPRKKEQDNMKVKCEPNTGGNEH
FTKQEYVNPAVSLFGVQHDNSGNGTGTSNNASGFCFRGQHHENMCSNKTLRPFYSREEQF
FSLSSTERENCQLHQGLQQCTADSYLEEYMKLPCPPVSPGTLYNNGLPCNTLIKTEYDSD
SENIANSHTILPSCVWVDENSIVKKHFPARVHLKTELNTQSSPQHCVYPPYNWQHIVMHH
TNNVRTGLGKAMTNKETSLLDLSKSIGTEAMESPQTPYYSNQFYSTFSVEEKGLNMQVLK
SHSEFKNLCFNQTVKHEPLDSHPISRSSQTTVGMTLCETPLADSHPHKIMQQQTV
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgattccaccaggggaatgtctgtatgctggaaggaaaagacggaaacccattcagaaa
cagaggcctacctctgggactggaaaaacaaatccttcaaagagacatagagaccgactg
aatgctgagctagatcacctggctagcctcctgcctttcccaccagacataatagctaaa
ctggataaactctctgttttacgtctcagcgtcagttatcttcgagttaaaagtttcttt
caagcagttcaagagaagcagctgagaaagcatgcaaatcatggaatgaaagatgttggt
gtcctcaaagaacctgtaatctcagaaggtggactcttactagagtcactgagtggtttt
gcactggtagtgagtggtgatggaatgatattctatgcatcaccaaccattgtggactat
ctaggatttcaccagactgatgtaatgcatcaaaatatatatgattatattcatgtggat
gatcgtctggatttctgcagacaactacattgggccatggatccaccaaagctagtatct
ggagaccatacacacagagagacaggggaagaatttattcttagcaaaatgtatacagaa
caggagagtgccaatacaacaacagacttttcatcatttttaactcgttgttttacttgt
cgaatccgctgcctcttggacagcacctctggtttccttaccatgcattttcaaggtaaa
ctaaaatttatctttggacagaagaagaaatcatcatcaggagcaatactacctccccag
ctatccttattctgcatagtggtgccactcctgcttccttcggtgacagacatgaagtta
aaaagtttttttgtgaaagcaaaatgcagatctgatcatgcagcatcagcaaatacaaac
tcaaaggctcattctggacagtgtttggctgattttcatagaagaaattctttccaagaa
ggagaatgtaatagagaaaatggcatttcactgatgagattccaagcaaacaaggaccac
tggttttgggtacaggctagtactcatgttcagtgcagaaatggttcctcagaatgcacc
attgctcttcaacaagctcccaaggaagagaaaattcagaagataccaaacatcatttca
agtataaaaggaaacagggaacaattgggacagatgaagcatcatacgtggagcccaagg
aaaaaagaacaggataacatgaaagtgaaatgtgaacctaatactggtggcaatgagcac
tttacaaagcaggaatatgttaatcctgctgtctcgctgtttggtgttcagcatgacaac
agtggaaatggcacggggacatcaaacaatgcatccggtttttgctttagaggtcagcat
catgagaacatgtgctctaacaaaactctaagacctttctacagtagagaggagcagttc
ttcagtttgtcatctacagagagagaaaattgtcagctacaccaaggcttgcagcaatgc
accgcagacagttatttggaagaatacatgaaattaccctgtcccccagtatctccagga
actctgtacaacaatggtttgccttgcaacacactgataaaaacggaatatgattcagat
tctgaaaatatagctaacagtcataccattttaccaagttgtgtatgggtggatgaaaac
agcatagtcaaaaagcactttcctgcaagagttcaccttaaaacagaactcaatacacaa
tcatccccgcaacattgtgtctatccaccgtataactggcaacacatagtgatgcatcat
accaataacgttagaactggacttggcaaagcaatgactaacaaagaaacatctttactg
gacctttcaaaatccattggcacagaagctatggagagcccacaaactccatattatagc
aatcaattctatagtaccttttccgtagaagagaaggggctgaatatgcaggttctgaag
tcacattctgagtttaaaaatctctgctttaatcagacagttaaacatgaacctttagat
tctcatcctatctccaggagtagtcagacaacagtggggatgactctctgtgaaacacca
ttagccgattctcatcctcataaaataatgcagcaacaaactgtgtga

DBGET integrated database retrieval system