KEGG   Anolis carolinensis (green anole): 100565586
Entry
100565586         CDS       T01608                                 

Gene name
dnajc21
Definition
(RefSeq) DnaJ heat shock protein family (Hsp40) member C21
  KO
K09506  DnaJ homolog subfamily A member 5
Organism
acs  Anolis carolinensis (green anole)
Brite
KEGG Orthology (KO) [BR:acs00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:acs03009]
    100565586 (dnajc21)
   03110 Chaperones and folding catalysts [BR:acs03110]
    100565586 (dnajc21)
Ribosome biogenesis [BR:acs03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100565586 (dnajc21)
Chaperones and folding catalysts [BR:acs03110]
 Heat shock proteins
  HSP40 / DNAJ
   100565586 (dnajc21)
SSDB
Motif
Pfam: DnaJ zf-C2H2_jaz zf-C2H2_2 zf-met zf-C2H2_4 zf-C2H2
Other DBs
NCBI-GeneID: 100565586
NCBI-ProteinID: XP_003224317
Ensembl: ENSACAG00000021095
UniProt: H9GQ08
Position
Un
AA seq 538 aa
MKCHYEVLGVKRDASDDDLKRCYRKLALRWHPDKNLENAEEAAEQFKLIQAAYDVLSDPQ
ERAWYDNHREALLKGGVDGEYQDDSLDLLRYFTATCYSGFGDDEKGFYTIYRNVFEMIAK
EEKESMMEEDMEEFPNFGDSQSDYDTVVHCFYGYWQSFCTQKKFAWKEEYDTRQASNRWE
KRAMEKENKKTRDKARKERNELVRELVAFIRKRDKRVQAHRKLLEEQNAEKAKKAEELRR
KQKLKQAKLAEEYKEQSWISMSDLERELQQMEAQYQKEFGDGSSDEDEKEEQECKEKQDD
KLSEEGDDASFYDDLYCPACDKSFKTDKAMKNHEKSKKHREMVALLRQQLEEEDEEFSPS
AVDENGLDSKEEEEAEEVPKQKLSKKQKKKQKTVVVEEDRSNDKSTQEQFNEANQGNGDV
KQAATKETEDVSKSHNPEDASPGETGEPPVDPKTEVTSNPKAKGKKTKDTKKTSTRISSD
HPATHESSLQCVTCHCEFQSRNKLFEHLKTSGHAKAMQEPAVQVAMSSRSKKEKRRNR
NT seq 1617 nt   +upstreamnt  +downstreamnt
atgaagtgccactacgaagtgctgggcgtgaagcgcgacgcctccgacgatgacctcaag
cgctgctacaggaagctggccctgcgatggcaccccgacaagaatctagaaaacgcggaa
gaagcggcagagcagttcaagctgatccaggctgcgtatgatgtgctgagtgatcctcaa
gaaagagcctggtatgacaatcaccgggaagctctgctgaaaggaggggtggatggagag
tatcaagatgacagtttggatttgctccgctacttcactgctacatgttactctggtttt
ggagatgatgagaaggggttctacacaatctatcggaatgtctttgaaatgattgcaaag
gaagaaaaggagtccatgatggaggaagacatggaagagtttccaaattttggagactct
cagagtgattatgacacagttgtccactgtttctacggttactggcagagtttctgcacc
cagaagaagtttgcctggaaagaagagtatgacacccggcaggcatcaaaccgctgggag
aaacgagccatggaaaaggagaacaagaagacccgtgacaaggcgagaaaggagcggaac
gagctggtacgcgagctggtggcctttatccggaaaagggacaagcgggtgcaggcccac
cggaagcttctggaggaacaaaatgccgagaaagcgaagaaagcagaggaactccggagg
aagcagaaactgaaacaagccaaactggccgaggagtataaagaacagagctggattagc
atgtcggacctggagcgcgagctgcagcagatggaagcacagtatcaaaaggagtttggt
gatgggtccagtgatgaagatgaaaaggaggaacaagagtgcaaagaaaagcaggatgat
aagttaagtgaagaaggagatgatgccagtttctatgatgatctctattgccctgcttgt
gataaatcctttaagacagataaagccatgaagaaccacgaaaagtccaagaagcatcga
gaaatggttgctttgttacggcagcaactagaggaagaagatgaagagttttctcccagt
gcagttgatgagaatggactggatagcaaagaggaagaggaggcagaagaagtgcccaag
caaaaactttctaagaaacagaaaaagaaacagaaaacagtggtggtggaagaggaccgt
tccaatgacaaaagcacacaggagcagtttaatgaagcaaatcaaggcaatggtgatgta
aagcaggctgcaaccaaagaaacagaagatgtcagcaaaagccacaatccagaagatgca
agtcctggagaaacaggagaaccaccagttgatcccaaaactgaggtgacaagcaaccct
aaagctaaagggaagaaaacaaaagacacaaagaaaacttccaccagaatttcttcagac
catccggcaacgcatgaaagttccctccagtgtgtcacctgccactgtgaattccagtca
cgaaataaactcttcgaacacttaaaaacttcaggccacgcaaaagccatgcaagaacca
gctgtccaagtcgccatgagcagcagaagcaaaaaagaaaaacgcagaaacagatag

DBGET integrated database retrieval system