KEGG   Aspergillus clavatus: ACLA_022630
Entry
ACLA_022630       CDS       T01148                                 

Definition
(RefSeq) nitrite reductase NiiA
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
act  Aspergillus clavatus
Pathway
act00910  Nitrogen metabolism
act01100  Metabolic pathways
Module
act_M00531  Assimilatory nitrate reduction, nitrate => ammonia
act_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:act00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    ACLA_022630
Enzymes [BR:act01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     ACLA_022630
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C FAD_binding_2
Other DBs
NCBI-GeneID: 4700663
NCBI-ProteinID: XP_001268975
UniProt: A1CPH8
AA seq 1103 aa
MPLIDGSKDHNTVHSHGSVNISIPHMGVVDPAGEVPVRRDEENRRQKIVVVGLGMVAVSF
IEKIVKQDAERRKYDIVVIGEEPHIAYNRVGLSSFFEHRKIEDLYLNPKEWYGSFKDRSF
DYHINTSVTDIFPDHKTVRTSTGDTIPYDILVIATGSDAVLPSHTPGHDANGIFVYRTIQ
DLERLIEFASKHKGETAVTVGAGLLGLEAAKAMTDLEEFGNVKLIDRNKWVLARQLDGDA
GTLVTRKIRELGLDVLQEKQVAKIKTDNGNNVTGIVFADGEEIDCCCICFAIGVRPRDEL
GISAGIQCAARGGFVINESLQTSIPDIYAVGECASWENQTFGIIAPGIEMADVLAFNLTN
PDKEPRSFKRPDLSTKLKLLGVDVASFGDFFADRDGPKFLPGRRPSVIDGAMEDTDGDKE
PVKALTYKDPFGGVYKKYLFTMDGKYLLGGMMIGDTKDYIKLNQMVKSQKPLEVPPSQFI
LGAQSDGEENADDLNDDAQICACHNVTKGDIVSNVKNGTCKSIAEVKSCTKAGTGCGGCM
PLVQSIFNKAMLDMGQEVSNNLCAHIPFPRADLYTVIAVKQLRSFVDVMKAVGRKPDSLG
CEICKPAIASILSSLFNQHIMDKELHDLQETNDRFLANIQRNGTFSVVPRVPGGEITADR
LITIGQVAKKYNLYCKITGAQRIDMFGAKKQDLLDIWTDLVDAGMESGHAYAKGLRAIKS
CVGTTWCRFGIGDSVGMAIRLEERYKSIRAPHKFKGAVSGCVRECAEAQNKDFGLIATDK
GFNIFVGGNGGAKPRHAELLAKDVPPEKVIPIVDRYLIFYIRTADKLQRTARWIENLPGG
INYLREVIIDDKLGIGAEMEQQMEELVNSYYCEWTETVRNPKRRKYFQQFANTDETVDTV
EVIKDRGQERPTYWPKDSANEDFKGHQWSSLAWQPVIKADYFSDEHPQISSANIKRGDTQ
LAIFKVKGKYYATQQMCPHKRAFVLSDGLIGDDDAGKYWVSCPYHKRNFELNGEQAGRCS
NDESMNIATFPVEERDDGWVYMKLPPVEELDSVLGTEKWKVKKGEAPDPFQKIDKRYKGI
RGKKACDITSQAPKTQAANIIDW
NT seq 3312 nt   +upstreamnt  +downstreamnt
atgcctttgatcgatggttcaaaggaccacaacactgtccatagtcatggcagtgtcaac
atcagcataccccatatgggagtagtcgatcctgcaggagaggtacctgttcgtcgcgat
gaagagaaccgacgacaaaagattgtggtggtgggactgggaatggtcgcggtctcattc
attgagaaaattgttaagcaagatgcagagagacgcaagtacgacatcgtcgtgatcggc
gaggagccgcacatcgcctacaaccgcgtcggtctttcctccttcttcgagcatcgcaaa
attgaagacttgtacctcaatccgaaagaatggtatggttcgttcaaagaccgatcattc
gattaccacatcaacaccagtgtgaccgacatcttccccgatcacaaaaccgttcggaca
tcaacaggcgacacgataccctacgatatcctcgtcattgcaacaggctcagatgcggtg
cttccctctcacacgcctggccacgatgccaatggtatttttgtttacagaacgatccaa
gaccttgagcgcctcattgagttcgcatcgaaacacaaaggtgaaaccgcagttaccgtt
ggagcaggcttactgggcctagaagccgccaaggcaatgacggacctggaagagtttgga
aatgtgaagcttattgatcgcaacaaatgggttcttgcacgacagctagatggcgatgca
ggaactctggtgactcgaaagatcagagaacttggtttggatgtgctacaagagaagcag
gtcgcgaaaatcaaaaccgacaacggtaacaatgtgactgggattgtcttcgcggatgga
gaagagatcgattgctgctgcatctgttttgcgattggagtgcgacccagggacgagtta
ggaatctcagctggcatccagtgcgctgcacggggaggatttgtgatcaatgaaagtctt
caaacctctattccagatatctatgcagtgggtgaatgtgctagctgggaaaaccaaaca
ttcggaatcattgcaccaggcatcgagatggctgatgtactggccttcaatctgaccaac
ccagataaggaaccgaggagtttcaagaggcccgacttaagcacaaaattgaagctattg
ggagttgatgttgccagcttcggtgacttcttcgctgacagagatggtccgaaattcctt
ccgggtcggcgaccatcagtcattgatggtgccatggaggacactgatggagacaaagag
ccagtcaaagccctcacatacaaggaccccttcggtggagtctacaagaagtatttgttc
acaatggatgggaaatacttgcttggcggcatgatgatcggagacaccaaggactatatc
aaactgaaccagatggtcaagagccagaagcctctcgaagtacctccaagccaatttatc
ctcggtgcgcaatcggacggtgaggagaatgccgatgatctcaatgatgatgctcagatc
tgtgcgtgtcacaatgtcactaaaggagacattgtctccaacgtcaagaacggcacatgc
aaatccattgccgaagtaaagtcttgtacaaaggcaggcactggctgtggaggttgcatg
ccattggtgcagtcaatcttcaacaaggccatgctggacatgggtcaagaagtctcgaac
aacctttgtgcacatattccgtttcctcgggccgatctctatacagtgatcgccgtcaaa
caattgagaagttttgttgatgtgatgaaggctgtgggaaggaagcctgactcccttggc
tgtgagatctgcaagcctgccattgcatcaattctttcaagtctattcaatcaacacatt
atggacaaggaactccatgaccttcaggaaactaacgacagattcctcgccaacattcag
agaaacggaaccttctctgtggtcccacgggtccctggtggcgaaatcacggctgatagg
ctgattacaattggccaagtggccaagaaatacaacctctactgcaagatcaccggcgct
cagcgtatcgacatgtttggcgccaagaaacaagacctactcgatatctggacggacctt
gtggatgctggaatggagagcggtcacgcttatgccaaaggtctgcgggcaatcaagagt
tgtgtcggaaccacatggtgccgtttcggtatcggcgatagcgttggaatggcaatccga
ctggaagagcgctacaagagtattcgagcacctcacaaattcaaaggcgccgtatccggc
tgtgtccgagagtgtgctgaggcccagaacaaggattttggattgattgcaactgacaaa
ggattcaatatctttgttggcggtaatggtggtgccaaacctcggcatgcagagttgctt
gcaaaagacgtgccccctgagaaagtgattccgatcgttgatagatacctcattttctac
atcaggaccgcagataaacttcaacgcacagcaagatggattgagaacctccccggcggt
atcaattatctgcgggaggttatcatcgacgataaactgggcatcggtgctgaaatggaa
cagcaaatggaagagctagtgaatagctactactgcgagtggactgagactgttcgaaac
cctaagcggcgcaagtacttccaacaatttgccaacaccgacgagacggtcgacacggta
gaagtcatcaaagatcggggccaggagcggcctacatactggcccaaagactctgcaaac
gaagacttcaagggtcatcaatggtccagtcttgcttggcagcctgtcatcaaggccgat
tacttctcggatgagcatccacagatctcatccgccaacatcaagcgcggcgacactcag
ctggccatattcaaggtcaagggcaaatattacgccacgcaacaaatgtgccctcacaag
cgagcttttgtcctatcggatggtctgattggagacgatgatgcgggcaaatactgggtt
tcttgtccttatcacaagcgcaattttgagctgaacggtgagcaggcgggaagatgctcg
aacgacgagagtatgaacattgctaccttccctgttgaggaacgtgacgatggctgggta
tacatgaaactacccccagttgaagagctggactctgtactgggaactgagaagtggaag
gtgaagaagggagaagcaccagaccctttccagaaaatcgacaagcgatacaaggggatc
agaggcaagaaggcgtgtgatattacttctcaagcgccgaagacacaggctgccaacatc
attgactggtag

DBGET integrated database retrieval system