KEGG   Acropora digitifera (stony coral): 107357921Help
Entry
107357921         CDS       T04352                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
adf  Acropora digitifera (stony coral)
Brite
KEGG Orthology (KO) [BR:adf00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:adf01002]
    107357921
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:adf04147]
    107357921
Enzymes [BR:adf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     107357921
Peptidases [BR:adf01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   107357921
Exosome [BR:adf04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   107357921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Peptidase_S15 Abhydrolase_6 RAP
Motif
Other DBs
NCBI-GeneID: 107357921
NCBI-ProteinID: XP_015780044
Position
Un
AA seq 239 aa AA seqDB search
MTMLIIRKHNFLVIRILHRMSEGIRERAAPSLTIRSNHRHEEKSDANVVMEKEQHRSLLL
FLVLGLFSFIWYFIKILFGAVTLCYILCVILMYTSPATRELIIYLHPLKNPFHNLSNPVS
FGLPANTVNFYISGPAGKLGAWNIPSINSVEKQDFSQANKHFNLKDDKPIILYLHGNAHT
RGAGHRVQLYKVLRSLGYHVITIDYRGFGDSEGTPSENGLIENGTKMCDIFVVTAASLI
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgctaatcattcgcaaacataactttttagttattagaatccttcatagaatg
tccgagggaattagggaaagagcggctccttctctaacaatacgctctaatcatcgtcat
gaagaaaaatcagacgcaaacgttgttatggagaaagaacagcacaggagtttactgctg
ttcctcgttttgggactcttttcatttatttggtattttatcaagattttgtttggagca
gttaccctttgttacattctttgcgttattctaatgtacacttcaccagctacaagagag
cttatcatatatttacaccctttgaaaaatccatttcacaacttgtcaaatccagtttca
tttggtttgcctgcaaatacggtgaatttttacatctctggtcctgctggaaaactcgga
gcatggaatattccctccataaattctgttgagaagcaagacttctcacaagcaaacaag
cattttaaccttaaagatgataaacccatcatactttatcttcatggtaacgctcataca
agaggagcaggtcacagagtacaactttacaaggttttaaggtcgttgggttatcatgtc
ataacgattgattatcgtggatttggtgactctgaaggaacaccctcagaaaacggtctc
atagagaatggcacgaaaatgtgcgacatctttgtcgtcacagctgcttctcttatttaa

DBGET integrated database retrieval system