KEGG   Aeromonas sp. CU5: CK911_06250
Entry
CK911_06250       CDS       T05327                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
aem  Aeromonas sp. CU5
Pathway
aem00230  Purine metabolism
aem01100  Metabolic pathways
aem01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CK911_06250
Enzymes [BR:aem01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     CK911_06250
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ATL92454
UniProt: A0A291TGX2
Position
1406666..1408984
AA seq 772 aa
MSIGLPLKRVDAEAKVTGSARYTDDNIMLGMRHAKYVRSNIAHGKVLAIDATEALALHGV
EAVFTHADVPTTCFRTAGHAWSLDETKRDVKDRRLLTDHVRHFGDGVAIVVARDPLVAEK
AASLVKVTYEPLPVMTDAASALAEGAYPIHPSGNLLRQSQLRANEPEQAIAAADLQFQAH
YRTPVVQHCHLETVTCYAYMDQPDHIIVVTSTQIPQIVRSRVAKSLGLPWSSVRVIKPYM
GGGFGNKQDVLEEPMAAFLSYKLGGVPVKVTLSREECFFASRTRHGFAIDGKMGLNRDGT
LKGYQLDVLSNTGGYASHGHSIASAGGNKISYLYPRSAFGYDAKTFYSNLPTAGAMRGYG
APQVIFALECMLDDACAELGLDPLAVRIANVAREGDVNQVNQKTIYSAGLPECLRRGGEQ
FEWERLKAECLGQDPASRMRRGIGVACFSYGSNTYPVGVEIAGARMLLNQDGTVNLQIGA
TEIGQGSDTVFAQMAAQTLGIPFEQIRVISTQDTDITAYDPGSFASRQSYVAAPAIHQAA
LQLRARILSLAAQLCHQDVGSLTLIDGYVVLAGAPDKVLISVAEVSINAYYHLTIGGQIT
AEVSHKTTTNPPSFGCTFVDLSVDIDLCKVTINRIMNLHDAGKILNPQLAEGQVHGGMGM
GIGWSLFEEMIIDPKTGVVRNPNLLDYKFPTMLDLPELECDFVQTYEPQSVYGHKSLGEP
PIISPGPAIRNAIRMATGVAINELPITPKTLFREFVAAGLITEGSREEQHHV
NT seq 2319 nt   +upstreamnt  +downstreamnt
atgtccataggattaccgctcaagcgggtggatgccgaggccaaggtgaccggcagcgcc
cgctataccgatgacaacatcatgctcgggatgcgccacgccaagtacgtgcgaagcaat
atcgcccacggtaaggtgctcgccatcgatgccaccgaggcgctggccctgcacggggtc
gaagccgtgtttacccatgcagatgtgcccaccacctgttttcgtaccgccggtcacgct
tggtcccttgatgagaccaaacgggatgtgaaagacaggcgcctgctcaccgaccatgtg
cgccatttcggtgatggggtcgccatcgtggtggcgcgcgatccgctggtggctgaaaaa
gcggcctcgctagtcaaggtgacctacgagccgttgccggtgatgacagatgctgcaagc
gcactggcggagggggcttatcctattcacccgagcggcaatctgctgcgccaaagccaa
ctcagagccaatgaaccagagcaggccattgctgccgccgatctgcagtttcaggcgcac
taccggacccctgtggtgcagcactgccatctggagacggtgacctgctacgcctacatg
gatcaacccgaccacatcatagtggtcaccagtacccagatcccccagattgtgcgcagc
cgggtggccaaatccctcggcctgccctggtccagcgtgcgggtgatcaagccctatatg
gggggtggttttggcaacaagcaggatgtgctggaagagccgatggcggcgtttttgagc
tacaaactgggcggcgtgccggtcaaggtgaccttgagccgggaagagtgcttcttcgcc
tcccgcacccgccacggctttgccatcgacggcaagatgggcctcaaccgcgacggcacc
ctcaagggctatcagctcgacgtgctctccaacacaggcgggtatgcctcccacggccac
tccatcgccagcgccggtggcaacaagataagctacctctatccgcgcagtgcctttggc
tacgatgccaagaccttctacagcaacctgcccaccgctggcgccatgcgcggttacggc
gcgccccaggtgatttttgccctcgagtgcatgctggatgacgcctgcgccgagctgggt
ctggatccgctcgccgtgcgtatcgccaacgtggcgcgcgaaggcgacgtcaatcaggtc
aaccagaagaccatctacagcgccggcttgcccgagtgtctgcgccggggtggcgaacag
ttcgagtgggaacggctcaaggccgagtgtctggggcaggatccggcgagccggatgcgg
cgtggcatcggcgtagcttgcttcagctacggctccaacacctatccggtgggggtcgaa
atcgccggggcccgcatgctgctcaatcaggatggcacagtcaatctgcagatcggcgcc
accgagatagggcaggggtcggacaccgtctttgcccagatggcggcccagaccctgggg
attccgtttgagcagatccgggtcatctcgacccaggataccgacatcaccgcctatgat
ccgggctcgttcgcctcgcgccagagctatgtggcggcccccgccatccatcaggcggcg
ctgcaactgagggcgcgcattctgtcgctggcggcccagctctgccatcaggatgtgggg
tcgctgaccctgatcgacggttacgtggtgctggccggtgcgccggacaaggtgctgatc
agcgtggccgaggtgtcaatcaacgcctactaccacctcaccataggcggccagatcacc
gccgaggtttctcacaagaccaccaccaacccgccgagtttcggctgcacctttgtcgat
ctcagcgtcgacatcgatctctgcaaggtgaccatcaatcgcatcatgaacctgcacgat
gcgggtaagatcctcaatccgcagttggcggaggggcaggtgcacggcggcatggggatg
gggatcggctggtccctgttcgaggagatgatcatagaccccaagaccggcgtggtgcgc
aaccccaacctgctcgactacaagttccccaccatgctggatctgcccgagcttgaatgc
gacttcgtgcagacctacgagccccagtctgtctatggccacaaatccctgggggaaccg
cccatcatctcccccggcccggcgattcgtaacgccattcgcatggccaccggggttgcc
atcaacgagctgcccatcacccccaagaccctgttccgggagtttgtcgccgcgggtctg
attaccgagggatcacgggaggagcaacaccatgtttga

DBGET integrated database retrieval system