KEGG   Aspergillus fumigatus: AFUA_8G05660
Entry
AFUA_8G05660      CDS       T01017                                 

Definition
(RefSeq) myosin I MyoA/Myo5
  KO
K10356  myosin I
Organism
afm  Aspergillus fumigatus
Brite
KEGG Orthology (KO) [BR:afm00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:afm01009]
    AFUA_8G05660
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:afm04131]
    AFUA_8G05660
   03036 Chromosome and associated proteins [BR:afm03036]
    AFUA_8G05660
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:afm04812]
    AFUA_8G05660
   04147 Exosome [BR:afm04147]
    AFUA_8G05660
Protein phosphatases and associated proteins [BR:afm01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AFUA_8G05660
Membrane trafficking [BR:afm04131]
 Endocytosis
  Phagocytosis
   Others
    AFUA_8G05660
 Others
  Actin-binding proteins
   Myosins
    AFUA_8G05660
Chromosome and associated proteins [BR:afm03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    AFUA_8G05660
Cytoskeleton proteins [BR:afm04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     AFUA_8G05660
Exosome [BR:afm04147]
 Exosomal proteins
  Proteins found in most exosomes
   AFUA_8G05660
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 SH3_1 SH3_2 SH3_9 IQ AAA_16 AAA_22 NACHT
Other DBs
NCBI-GeneID: 3504691
NCBI-ProteinID: XP_747367
UniProt: Q4WC55
Position
8
AA seq 1267 aa
MSTVNPHNQLQMKLFLTQKGHSRRPAGGEKKSRGFGRSKAVADVGDGRQTGGKPQVKKAT
FESTKKKEIGVSDLTLLSKISNEAINDNLKLRFEHDEIYTYIGHVLVSVNPFRDLGIYTD
NVLQSYRGKNRLEVPPHVFAVAESAYYNMKSYKDNQCVIISGESGAGKTEAAKRIMQYIA
SVSGGTDSSIQHTKDMVLATNPLLESFGNAKTLRNNNSSRFGKYLELEFNTNGEPVGANI
TNYLLEKSRVVGQITNERNFHIFYQFTKAAPQKYRDLFGIQQPQSYLYTSRSKCFDVPGV
DDSAEFRDTLNAMNVIGMTEGEQDEVFRMLAAILWIGNVQFAEDDSGNAVITDQSVVDYV
AYLLEVDAAQVNKAFTIRVMETARGGRRGSVYEVPLNTVQALAVRDALAKAIYFNLFDWI
VQRVNASLTARGEVANSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQD
EYAREQIQWTPIKYFDNKVVCSLIEDKRPPGVFAALNDACATAHADSSAADNTFVGRLNF
LSQNPNFENRQGQFIIKHYAGDVSYAVAGMTDKNKDQLLKDLLNLVGTSGNQFVHTLFPE
QVNQDDKRRPPTASDKIKASANDLVATLMKAQPSYIRTIKPNDNKAPREYNVGNVLHQIK
YLGLQENVRIRRAGFAYRQTFDKFVERFYLLSPKTSYAGDYTWTGDAESGARQILKDTSI
PAEEYQMGITKVFVKTPETLFALEAMRDRYWHNMAIRIQRAWRNYLRYRTECAIRIQRFW
RRTTGGLEFIKLRDQGHQLLNGRKERRRMSLLGSRRFLGDYIGVGNKGGPGEMVRNGAGI
SGSEEILFSCRGEVLVSKFGRSSKPAPRILALTNRHVYIIAQNLVNNQLVISSERTIPIG
AIKAVGASNLKDDWFSIVVGSPQEPDPLVNCVFKTEFFTHLNNALRGQLNLKIADHIEYN
KKPGKLATVKVVKDPAVARDDSYKSGTIHTGPGEPANSVSKPTPRPKQVSARPVTKGKLL
RPGGPGGGPSKLAARPTPAAQPLPRATPQPAEPQPAARAVPQPVAAVAASHTRTGSTASV
RAPPPPPPAAAPAPKKPTAKVLYDFNSQQSNELSIKAGEIVQIVSKEGNGWWLCMNMTTS
AQGWTPEAYLEEQVAPTPKPAPPPPPAAPRSTPAPATNGAAAAAKAKPAPPAPPAKRPNM
AARKAVPTPPPAPRDSAVSMNSHDSSGGSGRGTPNSMSNASLAGGLAEALRARQHAMQGK
QDDDDDW
NT seq 3804 nt   +upstreamnt  +downstreamnt
atgtctacagttaaccctcacaatcagcttcagatgaaattgttcttgactcagaaagga
cactcacgacgtcctgctggcggagagaagaagagtcgaggcttcggtcggtccaaagct
gtggctgatgtgggtgatgggcgacaaacggggggcaagcctcaggtgaagaaggccact
ttcgagagcacaaagaagaaggaaatcggggtttcagatcttacgttgttgagcaaaatc
tcgaacgaggccatcaatgacaacctgaagctgcgctttgaacatgacgagatctataca
tatatcggccacgtgttggtgtccgtcaaccctttccgagacctgggtatctacaccgac
aatgttctccagtcttatcgaggcaaaaatcgactcgaagtgcccccccacgtcttcgcg
gtcgcagaatcagcctactacaacatgaaatcttacaaggataaccagtgcgtgattatc
tcaggagagtcgggtgcaggaaagaccgaagctgcgaagcggattatgcaatacatcgcc
agtgtatctggaggcactgattcgtccatccagcataccaaggatatggtgctagctacc
aacccgttgctcgagtcgttcggcaatgcgaagaccctgcgcaataacaactcctcccgc
tttggaaagtatctcgaactggagttcaatacaaacggtgaaccagtgggtgccaatatc
accaactacttgctggagaaatccagagtagtaggacaaatcacaaacgagcgaaacttc
cacattttctaccaattcaccaaagcggcgccgcagaaatacagagatttgttcggcatc
cagcaaccgcaatcatacctctacaccagccgatcgaaatgttttgacgtccctggtgtt
gatgattctgctgagttccgcgatactttgaatgccatgaacgtgattggcatgacggag
ggtgagcaggatgaagtcttccgtatgctggctgcgatcttgtggatcggcaatgttcaa
tttgcagaagacgattctgggaacgccgttattacggatcagtcagttgttgactatgtt
gcgtacctcctggaggtggacgctgctcaggtgaacaaagcctttaccattcgggtgatg
gaaactgctcgtggaggtcgcagagggtcggtctatgaggttccactcaatacggtccaa
gctcttgctgtccgtgacgcgttggccaaggcaatctacttcaacctgtttgattggatt
gtgcagcgtgtcaacgcctccctaactgccagaggggaagttgcgaactcgattggtatt
ctggatatttatggcttcgagatcttcgaaaaaaactccttcgagcaactctgtatcaac
tatgtcaacgagaagttgcagcaaatcttcattcaattgactctcaaggctgagcaggat
gaatacgctcgcgagcagatccagtggactcccatcaaatactttgacaacaaggttgtg
tgctcgttgatcgaagacaagcgtccacctggtgtatttgctgctttaaacgatgcctgc
gcaacagcgcacgctgattctagcgctgcagataacaccttcgtcggacgactcaacttc
ctgtctcaaaatcccaactttgagaaccgccagggtcaattcattatcaagcattacgct
ggtgatgtcagctacgccgtggctggaatgacagacaagaacaaggaccagttgctgaaa
gatcttctgaatcttgtcggaacaagtgggaatcaattcgtccatacgctcttccccgag
caagtcaaccaggatgacaagagacgtcctcccaccgccagtgacaagatcaaggcctca
gccaacgacctggtggcaaccttgatgaaggcccagccctcgtatattcggacaatcaag
ccgaacgataacaaggcgcctagagagtacaacgtcggaaacgtcctgcatcagataaaa
taccttggattgcaggagaacgttaggatcagacgtgctggttttgcctaccgtcaaaca
ttcgacaagttcgtggagcgtttctatcttttgtcgcctaaaacgtcctatgcaggtgat
tacacttggacaggggacgccgaatccggcgctcgtcagatactgaaggataccagcata
cccgccgaagagtatcagatgggaattacaaaggtgtttgtcaagaccccagagacgttg
tttgctttggaagccatgcgtgaccgttactggcacaatatggccatccgaattcagcgt
gcctggcgaaactatcttcgctatcggactgaatgtgctattcgcattcagcgcttctgg
cgtcgcaccactggcggtcttgagttcattaagctgcgcgatcagggacatcagctgctc
aacgggcgtaaggagcgtcgccggatgagtctgcttggttctcgcagatttcttggtgat
tatatcggggtgggtaataaaggtggacccggcgagatggtccgtaacggtgcaggcatc
agcggatcagaggaaattctcttttcatgccgcggcgaggttttggtttcgaaatttggt
cggtccagcaagcctgctcctcgtatactggccttgaccaaccgccacgtatacatcata
gcgcaaaacctggtcaacaatcagctggtcatctcgtccgaaaggacgattccaatcggc
gccatcaaggctgtcggtgcctcgaacttgaaagatgactggttttcaattgtggttggc
agtccacaagaacctgaccctcttgtcaactgcgtgttcaagacggagtttttcacccac
ctgaacaacgcgctgcgcggacaattgaacttgaagattgccgaccacattgagtacaac
aagaagccgggcaaattggccaccgtcaaggtcgtcaaggatcctgctgttgcccgagat
gacagctacaagagtggtactattcacaccggtcctggggagcctgccaactcggtgtcc
aagccaaccccgaggcccaagcaagtcagtgcgcgtccagtcaccaaagggaagctactc
cgtcctggtggtccaggaggaggaccttccaagctggcagccagacccactcctgcagct
caacccctaccccgtgccacgccacagcctgctgaacctcagccagctgcgagggctgtt
cctcaacctgttgctgccgttgctgcttctcacactcgcaccggctcaacagcttcagtg
agggcgccgcctccacccccaccagccgctgcacctgctccgaagaaaccgaccgcaaag
gttttgtatgacttcaatagccagcaatccaacgagctgtcaatcaaggctggtgagatt
gtgcagattgtttccaaggaaggaaatggttggtggctgtgtatgaacatgacgacttcg
gcgcagggttggaccccagaagcatatctcgaagagcaagttgctccgacaccgaaacct
gcccctccgccgccgccagcagccccgaggtcgacccctgcaccagcgaccaacggtgcc
gccgcggcagccaaggccaagcctgcacctcccgcgcctccagcgaaacgaccgaatatg
gcagcacgcaaggcagtgcccacgccaccaccggctcctcgcgacagtgctgtcagcatg
aactctcacgactcttctgggggtagcggtcgtgggacacccaacagtatgtccaacgca
agcttagctggtggtctcgccgaggcactgagggcgcggcaacatgcaatgcaaggaaag
caggatgatgatgacgactggtga

DBGET integrated database retrieval system