KEGG   Acinonyx jubatus (cheetah): 106988561
Entry
106988561         CDS       T04657                                 

Gene name
AHRR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
aju  Acinonyx jubatus (cheetah)
Brite
KEGG Orthology (KO) [BR:aju00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:aju03000]
    106988561 (AHRR)
Transcription factors [BR:aju03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    106988561 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 106988561
NCBI-ProteinID: XP_026929072
Position
Unknown
AA seq 720 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFEAVQKCPRQPAAGTPSPEDSGLNGGSTVLEGRLLLESLD
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
VFGQPLHSDTGGSSALGRLLRSETHXLHSPTTVLHSLMVLLMCSVTTPPFLSLTHQTMQF
QGKLKFLFGQKRKTPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSGSV
DTKAKAASSLCDPASHGKPHCLAGRGIGENISALKAQADAGCWARIPARAPCPCLRSSPD
LVSDPEGAAGDRGGEEHGGVPGSTPGARGRRERPAYSCCFEAPGPVRHLNWMTGKHGPDG
GTNVKLGPSKSDPFSTHTVSRGSCVSCPGVQGTVHSSGVTAFRNSPGCHPGSPSPSAYAS
PTSRALQDSCKGPPLPSCPFPQGSLDNGLPPPGGQRLAAGGYSTEDAKFRGGPLPAGAPC
NPVLSLDVPVKLENDSGSEDAADGYLVSPGQVWPGAGGVAKRQLVTFPTRIHLKTESDSR
PHLYAPHLGHSMLGAHLSGRAPLRPGEEPAPSRPARCACLQHVRGLPEPDPPRHLRAHGH
QPPTLGRDCRAPGTTPVVKREPLDSPPWASHSQGGVPGMFPRSALPTLMPPKAPECAFLP
NT seq 2163 nt   +upstreamnt  +downstreamnt
atgatgattccaccaggggagtgcatgtatgctggaaggaaaagaaggaaacccattcag
aaacagaggccggccacgggggctgagaagtcaaacccgtccaagcggcaccgggaccgc
ctcaacgccgagctggaccacctggccagcctgcttccgcttcctcctgacatcgtgtct
aagctggacaagctttccgtcctgcgtctcagcgtcagctacctcagggtgaagagcttc
tttgaagccgtgcagaagtgcccacggcagccggcggctggtaccccctcaccagaagac
agtggtctgaacggagggtccaccgtgctggagggaaggctgctgctggagtctctcgat
ggctttgccctggtcgtgagtgcggaaggcatgatattttacgcgtcagcaacaatcgtg
gactatctgggcttccaccagacggacgtgatgcaccagaacatctatgactatatccac
gtggacgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggcg
gtgtttgggcagcccctgcactcagacacaggtgggtcttcggctcttggcagactcctg
agatcagagacccactgactgcatagccccaccacagttctgcattctctgatggtgttg
ctaatgtgctctgtgaccacacctccgtttctgtctttaacacaccagacaatgcagttt
caaggaaaactaaaattcctgtttggacagaagaggaagactccatcagggacagtcctg
ccccctcggctgtcactgttctgcatcgtggtgcccgtcctccttccttccgtggcggag
atgaaaatgaagagtgcgtttctgagagtgaagcacagggtggacgtctcaggctcagtg
gacacaaaagcaaaagccgcctcgagtctgtgtgacccagcatcgcatggaaaaccccac
tgcctggcagggaggggcattggagaaaacatttcagcgctcaaggcacaagcggatgca
ggctgctgggcccggattccagccagagccccatgtccctgcctcaggagcagcccggac
ctcgtttctgaccccgagggggccgccggggacaggggaggagaggagcacgggggggtg
cctggcagcactcccggagcccgggggcggagggaaagacctgcgtatagttgctgcttt
gaggcgcctggacccgtgaggcacctgaactggatgacagggaaacatggtccagatggt
ggcaccaacgtgaagctgggacccagtaagagtgacccgttctccacacacaccgtgtcc
cgtggctcctgcgtgtcctgccccggtgttcagggcactgtccatagcagtggggttact
gctttccggaattcacccggctgtcacccaggaagcccctctcccagtgcctatgccagc
cccacgagcagagccttgcaggacagctgcaaggggccccctctgcccagctgccccttt
ccccaggggagcctggacaatgggctccctccgcctggagggcagcgtctcgcagcgggg
ggctattccaccgaggacgccaagtttcgaggggggccgctgcccgcgggagccccgtgc
aaccccgtgctgtcacttgatgtgcccgtcaagctggagaacgactctgggtctgaggac
gcggcagacggctacctcgtgtccccaggccaggtgtggccgggagccggtggtgtggcc
aagagacagctggtcactttccctaccaggatacacctgaagacggagtcagactccaga
ccccacctgtatgctccgcacctggggcacagcatgctgggggctcacctgagcggcagg
gctccactcagacccggcgaggagccggcgccctcccgccccgcacgctgtgcctgcctg
cagcatgtgcgtggccttcccgagccagatcctccccgccacctccgtgcacacggtcac
cagccccctacactgggccgtgactgcagagctcccggcaccacacccgttgtcaagcgc
gagcccctggactcacccccatgggcaagccacagccagggtggggtgcccggcatgttc
cccagaagtgccttgccgacactgatgccccccaaagcccccgagtgtgctttcctgccg
tag

DBGET integrated database retrieval system