KEGG   Apis mellifera (honey bee): 726768
Entry
726768            CDS       T01057                                 
Name
(RefSeq) ATP-dependent RNA helicase dbp2
  KO
K12823  ATP-dependent RNA helicase DDX5/DBP2 [EC:5.6.2.7]
Organism
ame  Apis mellifera (honey bee)
Pathway
ame03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ame00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    726768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ame03041]
    726768
   03009 Ribosome biogenesis [BR:ame03009]
    726768
Enzymes [BR:ame01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.7  DEAD-box RNA helicase
     726768
Spliceosome [BR:ame03041]
 Complex A
  U1 snRNP components
   U1 related factors
    726768
 Complex B
    726768
Ribosome biogenesis [BR:ame03009]
 Eukaryotic type
  Pre-60S particles
   Helicases
    726768
SSDB
Motif
Pfam: DEAD Helicase_C ResIII ERCC3_RAD25_C PRAI
Other DBs
NCBI-GeneID: 726768
NCBI-ProteinID: XP_006560064
UniProt: A0A7M7GRP4
Position
LG14:3428757..3433756
AA seq 616 aa
MAYRDRERNDRRGGARGGGRFNSRDGNSGGGRFSSNSNRDSNFGNNNFKNRQPGERLRKP
RWDMSTLQPFRKDFYQPHPNVTTRSSHVVEAYRSDKEITVKGTNVPGPNIYFEEGGFPDY
VLNEIHRQGFGEPTAIQAQGWPIALSGRDMVGIAQTGSGKTLAYILPAIVHINHQPRLNR
NDGPIALILAPTRELAQQIQQVASDFGISSQVRNTCIFGGAPKGPQARDLERGVEICIAT
PGRLIDFLERGTTNLRRCTYLVLDEADRMLDMGFEPQIRKIVEQIRPDRQTLMWSATWPK
EVRNLAEEFLTDYIQINIGSLQLAANHNILQIVDVCEEYEKEGKLMKLLEEISNEPENKT
IIFVETKRKVDDITRAINRYGWQAIGIHGDKSQQERDYVLNQFRNSRSAILVATDVAARG
LDVEDVKFVINLDYPSNSEDYVHRIGRTGRSQRTGTAYAFFTPGNAHKASDLIQVLEEAK
QVVNPKLYELSRNPGIYKRGRYGGRSGGGSGRGSGGRGGGGSRGSRGGRDGDRGGRFDRS
NSGSGGDRGNKWNGNNSSMTSNKNCGIGSSSYNSKVFSQNNYGGSSGGGSNSYSQNGGYG
GSGGGSSGSNYRQNGY
NT seq 1851 nt   +upstreamnt  +downstreamnt
atggcataccgtgatcgtgaacgtaatgatagaagaggaggagcacgtggtggaggtcgt
tttaatagtagagatggaaatagtggaggtggaagatttagtagtaattccaatagagat
agtaattttggaaacaataattttaaaaacagacaacctggagaacggttacggaaacca
agatgggatatgagtacattacaaccatttagaaaagatttttatcagccacatcctaat
gttacaactcgaagttcacatgtagttgaagcttatcgttctgataaagaaattactgtg
aaaggaacaaatgtaccaggtccaaacatatattttgaggaaggtggatttccagattat
gtattaaatgaaattcatagacaaggatttggagaaccaactgcaattcaggcacaaggt
tggcctattgctttatctggacgtgacatggttggaattgctcaaactggatctggaaaa
acattagcatatattttaccagcaattgtacatataaatcatcaaccaagattaaaccga
aatgatggacctatagctctaattctggcaccaacaagagaacttgcacagcaaattcaa
caagttgcatcagattttggtatttcatcacaagtaagaaatacttgtatttttggtgga
gctccaaaaggtcctcaagctcgtgatcttgaacgaggtgttgaaatttgtatagcaaca
cctggacgtcttattgattttttagaacgaggtacaacaaatttacgtagatgtacatat
ttagtacttgatgaggcagatagaatgcttgatatgggttttgaaccacaaattagaaaa
attgtagaacaaatacgacctgatagacagactcttatgtggtctgcaacatggccaaaa
gaagttcgtaatcttgcagaagaatttttaactgattatatacaaattaacattggttct
ctacaattagcagctaatcataatattctccaaattgttgatgtatgtgaagaatatgaa
aaagagggtaaacttatgaaacttttagaagaaatatcaaatgaaccagaaaataaaact
atcatttttgttgaaactaagagaaaagtagatgatataacacgtgcaattaatagatat
ggatggcaagcaattggcatccatggtgataaaagtcaacaagaaagagattatgtatta
aatcagttccggaatagcagatctgccattctagtagctacagatgttgcagcaagagga
ttagatgtggaagatgttaagtttgtaataaatttggattacccgtccaattcggaagat
tatgtacatcggatcggacgtacgggacgatcacagcgtaccggaactgcgtacgcattt
ttcactcccggtaatgcacacaaggctagtgacttaatacaagttttagaagaagcaaaa
caagttgtaaatcctaaattatatgaattatcgagaaatccaggcatttataaaagaggt
cgttatggaggacgtagcggaggtggcagtggacgtggttctggaggccgcggtggcggc
ggttcacgaggttcgcgaggaggtcgtgatggagatagaggtggaagatttgatcgttct
aatagtggtagtggtggagaccgaggaaataaatggaatggcaataatagcagtatgact
tcaaataaaaattgtggtataggaagtagcagttataatagtaaagtattttctcaaaac
aattatggtggaagctctggtggtggttccaacagttatagtcaaaatggtggatatgga
ggaagcgggggaggaagtagtggcagtaattatagacaaaatggttattaa

DBGET integrated database retrieval system