KEGG   Ailuropoda melanoleuca (giant panda): 100466467
Entry
100466467         CDS       T01329                                 

Gene name
ANKRD53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
aml  Ailuropoda melanoleuca (giant panda)
Brite
KEGG Orthology (KO) [BR:aml00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aml03036]
    100466467 (ANKRD53)
Chromosome and associated proteins [BR:aml03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100466467 (ANKRD53)
SSDB
Motif
Pfam: Ank_2 Ank Ank_5 Ank_4 Ank_3
Other DBs
NCBI-GeneID: 100466467
NCBI-ProteinID: XP_002914960
Ensembl: ENSAMEG00000015860
Position
4
AA seq 490 aa
MQPAEKVSYKVTCSDAASQQPRAASPDPDPAFPLACPLPTLHPCAHAKPDDEWDQSAIGS
YYELFAAALGNLEWLRFCLSRDRDKIPADDKGFTAIHFAAQSGKLPCLQLLVEEYQFPVD
LPTSSGQTPLHLVIHGDNKTMTLPCIHYLLKRGAALNTQTCNGSTPLHLAACKGLLSCVK
VLVQNGANVHARDAVGCKPIDYCKIWNHRDCARFLKDAMWKRDKKDFAREMGKLKRLKDQ
LVFMEQDYLTEYQKEHQILREADFKKWLHCKKLLWGQSTICKAKQAPCAAPQAIPISKTP
KHQRPWKSFYPSPEARLRQTSGPKLQPLGTPTPIYTHPVVRRPKLWNVSNNPARSPTTQI
GYPQGIRLGVHPDPRPEQDFCSFLEVRSDRHGGAQLCTVAGHPVAPVPQLPFEVVVRELH
PSVWPPRMKVPQGFCPVSMRNVPQKRHLGDDNFWTDTLAMNLRETFDEAFLAAVRAHQGL
PTLPSPTSPP
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgcagccagcggagaaagtctcgtacaaggtcacctgttccgacgcggcgtcccagcag
cccagggccgccagcccagacccagacccggctttcccgctcgcctgcccactcccgacc
ctccatccctgcgcccacgctaagcccgatgatgagtgggaccagagtgccattgggagc
tactacgagttgttcgcggccgcactgggcaacctggaatggttgcgcttctgtctgagt
cgggaccgtgacaaaattccggcagatgacaagggcttcactgccatccactttgcagcc
cagagtggcaagctgccgtgcctgcagctcttggtagaggagtaccagtttcccgtggac
ctgcccaccagcagtggccagacacccctgcacctggtcatccacggggacaacaagacc
atgaccctcccctgcattcactatctacttaagcgaggggcggccctcaacactcagaca
tgcaatggctccacacccctccacctggcagcctgcaagggcttgctgagctgcgtgaag
gtgctggtgcaaaatggtgccaatgtccatgcccgagacgccgtgggctgcaagcccatc
gactactgcaaaatatggaaccaccgtgactgtgcccggttcttgaaggatgccatgtgg
aaacgggacaagaaggactttgctcgtgagatggggaaactgaagaggctcaaggaccag
ctggtcttcatggaacaggactacctgactgagtatcaaaaagagcaccaaattctgaga
gaagctgatttcaagaagtggctccattgcaagaagctgctctggggccaatccacgatc
tgcaaggccaagcaagcgccttgtgccgcaccccaggcgatccccatctccaagaccccc
aagcaccagaggccttggaagagcttctacccctccccagaggcacgcctgaggcagaca
tcagggcccaagctgcagcccttggggacacccacacccatctacacccaccccgtggtc
agacggcccaagttgtggaatgttagcaataaccctgccagatcgcccaccacccagatc
ggctacccacagggcatccgcctgggtgtgcatccagaccccaggccagagcaagacttc
tgcagcttcctcgaggtgaggtctgacaggcacggcggtgcgcagctgtgcacggtggcc
ggccacccggtggcgcctgtgccccagctgcctttcgaggtggtagtccgagagctgcac
ccttcagtgtggccacccaggatgaaagtgccccagggcttctgccctgtcagcatgagg
aatgtgccccagaagcggcacttgggtgatgacaacttctggaccgacactctggccatg
aacctccgtgagacatttgatgaagccttcctggcagctgtgcgagcccatcaagggctc
cccactctgccctcccccacaagccccccataa

DBGET integrated database retrieval system