KEGG   Ailuropoda melanoleuca (giant panda): 100470471
Entry
100470471         CDS       T01329                                 

Gene name
IL12A
Definition
(RefSeq) interleukin-12 subunit alpha isoform X2
  KO
K05406  interleukin 12A
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04620  Toll-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04940  Type I diabetes mellitus
aml05133  Pertussis
aml05134  Legionellosis
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05144  Malaria
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05162  Measles
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05200  Pathways in cancer
aml05321  Inflammatory bowel disease
aml05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100470471 (IL12A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100470471 (IL12A)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100470471 (IL12A)
   04622 RIG-I-like receptor signaling pathway
    100470471 (IL12A)
   04625 C-type lectin receptor signaling pathway
    100470471 (IL12A)
   04658 Th1 and Th2 cell differentiation
    100470471 (IL12A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100470471 (IL12A)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100470471 (IL12A)
   05330 Allograft rejection
    100470471 (IL12A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100470471 (IL12A)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100470471 (IL12A)
   05134 Legionellosis
    100470471 (IL12A)
   05152 Tuberculosis
    100470471 (IL12A)
  09172 Infectious disease: viral
   05162 Measles
    100470471 (IL12A)
   05164 Influenza A
    100470471 (IL12A)
   05168 Herpes simplex virus 1 infection
    100470471 (IL12A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100470471 (IL12A)
   05144 Malaria
    100470471 (IL12A)
   05145 Toxoplasmosis
    100470471 (IL12A)
   05140 Leishmaniasis
    100470471 (IL12A)
   05142 Chagas disease
    100470471 (IL12A)
   05143 African trypanosomiasis
    100470471 (IL12A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100470471 (IL12A)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100470471 (IL12A)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100470471 (IL12A)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100470471 (IL12A)
SSDB
Motif
Pfam: IL12
Other DBs
NCBI-GeneID: 100470471
NCBI-ProteinID: XP_002929591
Position
1
AA seq 403 aa
MVCPHPFRTGWAVTTRARPGHRWRARAPLGAPWGGGAAGRRRQGRRARPEGLCGPGPRVA
REGSGLPGDPAPRLCANFAFALGRLEAAGPSPERLRPGTAELIRKRLKPRGPNSTCHREA
DVERDRERKQAGAQSPGKVLPRLGAIIKMGPPGPASHHRPHLLRPQSASSAGPGSTQCPL
SMCPPRGLLLVTILVLLTHLDHLSLARSLPPASPSPGMFLCLNHSQNLLRAVSNSLQKAR
QTLELYSCTSEEIDHEDMTKDKTSTVEACLPLELTMNESCLASREISLITNGSCLASRKA
SFMTILCLSSIYEDLKMYQVEFKAINAKLLMDPKRQIFLDQNMLTAIDDLLQALNFNSVT
VPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRMMSYLNSS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atggtttgcccgcaccctttcaggactgggtgggcggtcacgaccagggcacgtccggga
cacagatggagagcgcgggcaccactcggcgctccgtggggagggggcgctgcagggcgg
cggcgccagggccgcagggctcggccggagggcctctgcggcccgggaccgagggtggcc
cgcgaggggtcgggcttgcccggggaccccgcgccacgactctgcgcgaatttcgctttc
gctttgggccggctggaggcggcggggccgtccccagaacggctgcggccgggcaccgcg
gagttaatccgaaagcgcctcaaaccccgcgggccgaactccacgtgtcaccgagaagct
gatgtagagagagacagagagagaaagcaagcaggagcccagagtcccgggaaagtcctg
ccgcgcctcggggcaattataaaaatgggaccccccgggccggcctcccaccaccgccct
cacctgctgcgccctcagtccgcgtccagcgccggcccggggtccacgcagtgcccgctc
agcatgtgcccgccgcgcggcctcctcctcgtgaccatcctggtcctcctaacccacctg
gaccacctcagtttggccaggagcctccccccagcctccccaagcccaggaatgttcctg
tgcctcaaccactcccaaaacctgctgagagccgtcagcaactcgcttcagaaggccaga
caaactctagaactttactcctgcacttctgaagagattgatcatgaagacatgacaaag
gataaaaccagcacagtggaggcctgcttaccgttggaattaaccatgaatgagagttgc
ctggcttccagagagatctctttgataactaatgggagttgcctggcatccagaaaggcc
tcttttatgacaatcctgtgcctcagcagcatctatgaggacttgaagatgtaccaggtg
gagttcaaggccattaacgcaaagcttctaatggatcctaagaggcagatctttctggat
caaaacatgctgacagctattgatgacctgttacaggccctgaatttcaacagtgtgact
gtgccacagaaatcctcccttgaagaaccggatttttataaaactaaaatcaagctctgc
atacttcttcatgctttcagaattcgggcggtgaccatcgatagaatgatgagctatctg
aattcttcctaa

KEGG   Ailuropoda melanoleuca (giant panda): 100477772
Entry
100477772         CDS       T01329                                 

Gene name
IL12B
Definition
(RefSeq) interleukin-12 subunit beta
  KO
K05425  interleukin 12B
Organism
aml  Ailuropoda melanoleuca (giant panda)
Pathway
aml04060  Cytokine-cytokine receptor interaction
aml04620  Toll-like receptor signaling pathway
aml04622  RIG-I-like receptor signaling pathway
aml04625  C-type lectin receptor signaling pathway
aml04630  JAK-STAT signaling pathway
aml04658  Th1 and Th2 cell differentiation
aml04940  Type I diabetes mellitus
aml05133  Pertussis
aml05134  Legionellosis
aml05140  Leishmaniasis
aml05142  Chagas disease
aml05143  African trypanosomiasis
aml05145  Toxoplasmosis
aml05146  Amoebiasis
aml05152  Tuberculosis
aml05162  Measles
aml05164  Influenza A
aml05168  Herpes simplex virus 1 infection
aml05200  Pathways in cancer
aml05205  Proteoglycans in cancer
aml05321  Inflammatory bowel disease
aml05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:aml00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100477772 (IL12B)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100477772 (IL12B)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100477772 (IL12B)
   04622 RIG-I-like receptor signaling pathway
    100477772 (IL12B)
   04625 C-type lectin receptor signaling pathway
    100477772 (IL12B)
   04658 Th1 and Th2 cell differentiation
    100477772 (IL12B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100477772 (IL12B)
   05205 Proteoglycans in cancer
    100477772 (IL12B)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100477772 (IL12B)
   05330 Allograft rejection
    100477772 (IL12B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100477772 (IL12B)
  09171 Infectious disease: bacterial
   05133 Pertussis
    100477772 (IL12B)
   05134 Legionellosis
    100477772 (IL12B)
   05152 Tuberculosis
    100477772 (IL12B)
  09172 Infectious disease: viral
   05162 Measles
    100477772 (IL12B)
   05164 Influenza A
    100477772 (IL12B)
   05168 Herpes simplex virus 1 infection
    100477772 (IL12B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100477772 (IL12B)
   05145 Toxoplasmosis
    100477772 (IL12B)
   05140 Leishmaniasis
    100477772 (IL12B)
   05142 Chagas disease
    100477772 (IL12B)
   05143 African trypanosomiasis
    100477772 (IL12B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:aml04052]
    100477772 (IL12B)
   00536 Glycosaminoglycan binding proteins [BR:aml00536]
    100477772 (IL12B)
Cytokines and growth factors [BR:aml04052]
 Cytokines
  Interleukins
   100477772 (IL12B)
Glycosaminoglycan binding proteins [BR:aml00536]
 Heparan sulfate / Haparin
  Cytokines
   100477772 (IL12B)
SSDB
Motif
Pfam: IL12p40_C Ig_3 Ig_5 Ig_4 fn3 Ig_2 DBD_Tnp_Mut
Other DBs
NCBI-GeneID: 100477772
NCBI-ProteinID: XP_019650508
Ensembl: ENSAMEG00000006528
Position
3
AA seq 329 aa
MQLQQLVISWFSLVLLASPLMAVWELEKNVYVVELDWHPGAPGEVVVLTCRTPEEDDITW
TSDQSSEVLGSGKTLTVQVREFGDAGRYTCHKGGKVLSDSLLLIHKKEDGIWSTDILKEQ
KESKNRIFLKCEAKNYSGRFTCWWLTAISTDLKFSVKSSRGFSDPQGVTCGAVTLSADRV
RVDNRDYKKYTVECQEGSACPTAEESLPIEVVVDAVHKLKYENYTTSFFTRDIIKPDPPM
NLQLKPLKNSRQVEVSWEYPNTWSTPHSYFSLTFCIQGQGKNHREKKERLCVDKTSAKVT
CHREAKIRVQARDRYYSSSWSDWAAVSCT
NT seq 990 nt   +upstreamnt  +downstreamnt
atgcagctgcagcagctggtcatctcctggttctccctggttctgttggcatctcccctc
atggccgtatgggaactggagaaaaatgtttatgttgtagagttggattggcacccgggc
gcccccggagaagtggtggtcctcacctgccgtacccctgaagaggatgacatcacctgg
acctcggaccagagcagtgaagtcttaggctctggtaaaactctgaccgtccaagtcaga
gaatttggagatgctggccgatatacctgtcataaaggaggcaaggttctgagcgattca
ctcctgctgattcacaaaaaggaagatggaatttggtccactgatatcttaaaggaacag
aaagaatccaaaaataggatctttctaaaatgtgaggcaaagaattattctggacgtttc
acctgctggtggctgacggcaatcagtactgacttgaaattcagtgtcaaaagcagcaga
ggcttctctgacccccaaggggtgacatgtggagcagtgacgctctcagcagacagggtc
agagtggacaacagggattataagaagtacacggtggagtgtcaggagggcagtgcctgc
cccacagccgaggagagcctccccatcgaggtcgtggtggacgctgttcacaagctcaag
tatgaaaactacactacgagcttcttcaccagggatatcatcaaaccggacccgcccatg
aacctgcagctgaagccgttaaaaaattctcggcaagtggaggtcagctgggaatacccc
aacacttggagcaccccgcattcctacttctccctgacattctgcatacagggccagggc
aaaaaccatcgggaaaagaaagagagactctgcgtggacaagacctcggccaaggtcaca
tgccacagggaggccaagatccgcgtgcaagcccgagaccgctactacagctcgtcctgg
agcgactgggcagctgtgtcctgcacttag

DBGET integrated database retrieval system