KEGG   Amycolatopsis mediterranei S699: RAM_14095Help
Entry
RAM_14095         CDS       T01822                                 

Definition
(GenBank) GTP cyclohydrolase II/3,4-dihydroxy 2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
amn  Amycolatopsis mediterranei S699
Pathway
amn00740  Riboflavin metabolism
amn00790  Folate biosynthesis
amn01100  Metabolic pathways
amn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:amn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    RAM_14095
   00790 Folate biosynthesis
    RAM_14095
Enzymes [BR:amn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     RAM_14095
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     RAM_14095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: AEK41307
UniProt: G0G9P6
Position
2960975..2962303
Genome map
AA seq 442 aa AA seqDB search
MSETSAVEPEAGWTPCGSGAVFDADAIERAISDIAAGRPVVVVDDEDRENEGDLIFAAEK
ATPELLAFMVRYTSGYVCVALTESEADRLDLPPMYHTNQDARGTAYSVTVDAAEGISTGI
SAADRAHTIRLLADPASTAKDFRRPGHVVPLRAKEGGVLRRPGHTEASVDLARMAGLAPA
GVLCEIVSQKDEGDMARRDELEVFAADHDLAIITIADLIAYRRRTEKQVERVAEARIPLA
AGTFRAVGYDSLLDGIEHVAFVYGEIGDGQDILVRVHSECLTGDVFGSLRCDCGPQLEAA
LEAVAAEGRGVVLYIRGHEGRGIGLLHKLQAYQLQDDGADTVDANLALGVPADARDYGTG
AQILCDLGVRTMRLLSNNPAKRIGLEGYGLRVTGRVPLPISPNPENLRYLRTKRDRMGHD
LAQLEHYDQVGAAPEHVDGGTL
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagacgagtgcggtggagcccgaggcgggctggaccccgtgcggcagcggagcg
gtgttcgacgccgacgccatcgagcgggcgatctcggacatcgcggcgggccgcccggtc
gtcgtggtcgacgacgaggaccgcgagaacgagggtgacctgatcttcgccgccgagaag
gcgacgccggagctgctggccttcatggtccgctacacctcggggtacgtctgcgtggcg
ctgaccgagtccgaagcggaccggctggacctgcccccgatgtaccacacgaaccaggac
gcgcgcgggaccgcgtacagcgtcacggtcgacgccgccgaaggcatcagcaccggcatc
tccgccgccgaccgcgcgcacacgatccggctgctggccgacccggcgtccacggcgaag
gacttccgccgccccggccacgtcgtgccgctgcgggccaaggaaggcggcgtgctgcgc
cggccggggcacaccgaggcgtcggtcgacctggcccggatggccggcctcgcgcccgcc
ggcgtgctctgcgagatcgtgtcccagaaggacgaaggcgacatggcgcgccgcgacgag
ctcgaggtgttcgccgccgaccacgacctggcgatcatcaccatcgccgacctgatcgcc
taccgccgccgcaccgagaagcaggtcgagcgggtcgcggaagcccggatcccgctggcc
gcgggcacgttccgggcggtcggctacgactccctgctggacggcatcgagcacgtcgcg
ttcgtctacggcgagatcggcgacggccaggacatcctggtccgcgtgcactccgagtgc
ctcaccggtgacgtcttcggctcgctgcgctgcgactgcggcccgcagctggaggcggcc
ctggaagcggtggccgccgaaggccgcggcgtcgtgctctacatccgcggccacgagggc
cgcggcatcggcctgctgcacaagctgcaggcctaccagctgcaggacgacggcgcggac
accgtcgacgcgaacctcgcgctcggcgtcccggccgacgcccgcgactacggcaccggc
gcacagatcctctgcgacctcggcgtccgcaccatgcggctgctgtcgaacaacccggcc
aagcggatcggcctggagggctacggcctgcgcgtgaccgggcgggtgccgctgccgatt
tcgccgaacccggagaacctgcgctacctgcggaccaagcgcgaccggatgggccacgac
ctggcccagctggagcactacgaccaggtcggcgcggcccccgagcacgtcgacggagga
accctgtga

DBGET integrated database retrieval system