KEGG   Aspergillus niger: ANI_1_128054
Entry
ANI_1_128054      CDS       T01030                                 

Gene name
An06g01120
Definition
(RefSeq) ubiquitin-conjugating enzyme E2 2
  KO
K10573  ubiquitin-conjugating enzyme E2 A [EC:2.3.2.23]
Organism
ang  Aspergillus niger
Pathway
ang04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    ANI_1_128054 (An06g01120)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ang04121]
    ANI_1_128054 (An06g01120)
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_128054 (An06g01120)
Enzymes [BR:ang01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     ANI_1_128054 (An06g01120)
Ubiquitin system [BR:ang04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   ANI_1_128054 (An06g01120)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  TLS (translesion DNA synthesis) factors
   Rad6 epistasis group
    ANI_1_128054 (An06g01120)
SSDB
Motif
Pfam: UQ_con RWD
Other DBs
NCBI-GeneID: 4981111
NCBI-ProteinID: XP_001390939
UniProt: A2QLG6
AA seq 151 aa
MSTSARRRLMRDFKRMQTDPPAGVSASPVADNVMTWNAVIIGPADTPFEDGTFRLVMHFE
EQYPNKPPGVKFISQMFHPNVYGTGELCLDILQNRWSPTYDVAAILTSIQSLLNDPNTSS
PANVEASNLYKDNRKEYIKRVRETVEKSWED
NT seq 456 nt   +upstreamnt  +downstreamnt
atgtcgacctctgcccgccgtcgtctcatgcgcgacttcaagcgtatgcaaactgaccct
cctgctggagtttctgcctctcctgtggcggacaatgtcatgacctggaacgccgtcatc
atcggccccgctgatactccctttgaagatggcactttccgccttgtcatgcacttcgag
gagcagtacccaaacaagcctccgggcgtcaagtttatcagtcagatgttccaccccaac
gtctacggtacgggcgagctctgtctggacattctacagaaccgttggagcccaacctat
gacgtggcagccatcctgaccagtattcagagtctgttgaacgatcccaacacatcatct
ccggcgaatgtagaagcgtcaaacctttacaaagacaaccggaaggagtacatcaagcgc
gtgcgcgagaccgtcgagaagagctgggaggactag

DBGET integrated database retrieval system