KEGG   Aspergillus niger: ANI_1_2186094
Entry
ANI_1_2186094     CDS       T01030                                 

Gene name
An11g06730
Definition
(RefSeq) FF domain protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: FF WW VGLL4 DUF5641
Other DBs
NCBI-GeneID: 4984897
NCBI-ProteinID: XP_001394651
UniProt: A2QWW8
AA seq 573 aa
MLKSTYTPPPPLPPGWTEHKAPSGHLYYYNSQTKQSTYTRPQATPVQPPPAPAPEPTNNA
PFLTPDTLPPFSSTPYAPHGFGHSAASHGPPFDGQSRGGFRGGRGYHDRKPRGLQDRPKT
KHDIPGCAPWILVKTKLGRRFVHNPETNESFWKIPPEVLVGVLEYDRLEREAKERKERGE
ETEDVAKGKPEAQESDQPRREEAESGAATAAGEESDEYEEVEVTDSEGEEEQPFKRPRTE
EGDEQQPMEFTEEDMEYQLAAMGEEYGLDPGEYGEPGEEEWEEGAEGLPLTEEDATALFR
DLLDDYRINPFSTWEKIIEEGRIIDDSRYTVLPNMKTRREVWSNWSRDRIQELKERKEKE
EKKDPRIKYLAFLQEHATPKLYWPEFKRKYKKEPEMKDTQLSDKDREKYYRDLISRLKQS
ESTRKSDLSALLKSVPLHELNRSSNLEALPPSIITDLRYIALMPKVRNPLIEAYISTLPA
APESDMTAEEREELERKKVERDRREKALAEREKQVQEEKRKQKGELVRGKHLLREGEAEI
EEAMRINRGGLRSYIEAEDQSSKGQGENASQQP
NT seq 1722 nt   +upstreamnt  +downstreamnt
atgctcaaatctacgtataccccaccccctccgttacctccagggtggaccgaacataaa
gctccttcaggtcatctgtattactacaactcgcagaccaagcaatccacatatacaagg
cctcaggccactcccgtacaacctccgcctgcacctgcaccagaacccacgaataacgcg
ccattcctaaccccagatacacttcctcccttttcttcgactccttatgctcctcatggt
tttgggcatagcgctgcatctcacgggccacctttcgatggtcagtcacgcggaggcttt
cgcgggggcagaggataccatgaccgcaaaccccgtgggctacaggataggcctaaaacc
aaacatgatattcctggatgcgcgccatggatactcgtgaagacgaagctgggaaggaga
tttgttcacaaccccgaaacgaacgaaagtttttggaagatccctccagaggtactggta
ggagtccttgagtacgatcgcttggagagagaggcgaaggaaaggaaggagcggggcgag
gagacggaagatgtcgccaaaggaaaacccgaagctcaggagtcggatcaaccacggcgg
gaagaagcagagagtggtgccgctacggcagctggggaggagagcgatgagtatgaggag
gtcgaagttactgatagcgagggtgaggaagagcaacctttcaaacgaccgagaaccgaa
gaaggggacgaacagcagccgatggagttcactgaagaagatatggaatatcaattagcg
gcaatgggcgaagaatatggccttgaccctggcgaatacggcgaacccggagaagaagaa
tgggaagagggcgcagaagggcttccgctcacggaggaggatgccacagccttattccgt
gatcttcttgacgactatcgcattaacccgttctccacgtgggaaaagatcatcgaagaa
ggtcggatcattgacgatagccgctacactgtgctgccaaacatgaaaacgcgtcgtgag
gtctggtccaactggagtcgtgaccggattcaagaacttaaagaacgcaaagagaaggaa
gaaaagaaggacccgcgcatcaagtacttggccttcctccaggaacacgccacaccaaag
ttgtattggcccgagttcaagcgcaaatacaaaaaggaaccagaaatgaaggatacgcaa
ttgtcagacaaagatcgagaaaagtactaccgcgacttgatttctcgattgaaacagtca
gaaagcacgcgaaagtctgacctttcagcgctactaaaatctgtaccactgcacgaactc
aatcggtcgtctaatctggaggctcttcctccttccatcatcaccgatctcagatacatc
gcccttatgcccaaagtgcggaatccgcttatcgaggcttacatctctaccttgcctgct
gctccggaaagcgacatgaccgccgaggaaagagaagagctagaacggaagaaggttgaa
cgtgatcgacgcgaaaaggcgttggcagaacgagagaagcaggtacaagaggagaagaga
aagcaaaaaggcgagcttgttcgcggtaaacaccttttgagagaaggggaagcggagatc
gaggaagctatgaggatcaatagaggaggacttcgcagctacattgaagccgaagatcaa
tcttcaaagggccaaggcgagaacgccagtcagcagccatga

DBGET integrated database retrieval system