KEGG   Asparagus officinalis (garden asparagus): 109845542Help
Entry
109845542         CDS       T05243                                 

Definition
(RefSeq) probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
aof  Asparagus officinalis (garden asparagus)
Pathway
aof03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:aof00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    109845542
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:aof03041]
    109845542
Enzymes [BR:aof01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     109845542
Spliceosome [BR:aof03041]
 Complex C
  Other components
   Step II factors
    109845542
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 AAA_19 AAA_30 T2SSE DUF2075 AAA Sigma54_activ_2 ABC_tran Flavi_DEAD AAA_16 PhoH
Motif
Other DBs
NCBI-GeneID: 109845542
NCBI-ProteinID: XP_020270390
Position
6
AA seq 1169 aa AA seqDB search
MVESAVDNGDGLKKLEYLSLVNQVCTELESNLGVGDKVLAEFITDLGRKSETVEDFDKKL
KENGAEMPDYFVKTLLTIIHAILPPKPKSKSKSDLKSQSSGLFHGLARPDDRQRVKNLQE
EILKEAEEKADAEARNREEEDRDRRHRDQPRDRDRDRDRDRDRRHRRDRDRYRGRGSDDE
RERDRYRGRGSDDEGGDFNSSREHPRRNSDEPELYRVYKGRVSRVMDTGCFVQIPELRGK
EGLVHVSQIATRRVVNVKEVVKRDQEVFVKVISFSGQKLGLAMRDVDQKTGRDLLPIRKT
SEDDALRANPLSGNSNGPTKRMGLSGIMITEEDESMPARRRPLKRMSSPEKWEAKQLIAA
GVMDVRDYPNFDEDGDGVLYQEEGAEEELEVELNEDEPAFLQGQSRFSMDMSPVKIFKNP
EGSLSRAAALQSALIKERREVREQQQRTMLDSIPKDLNRPWEDPMPETGERHLAQELRGV
GLSAYDMPEWKKDAYGKALTFGQRSKLSIQEQRQSLPIYKLKKELVQAVHDNQVLVVIGE
TGSGKTTQVTQYLAEAGYTTRGKIGCTQPRRVAAMSVAKRVAEEFGCRLGEEVGYAIRFE
DCTGPETVIKYMTDGMLLREILVDENLSQYSVVMLDEAHERTIHTDVLFGLLKQLVQRRP
DLRLIVTSATLDAEKFSGYFFNCNIFTIPGRTFPVEILYAKQPESDYLDAALITVLQIHL
TEPEGDILLFLTGQEEIDHACQALYERMKGLGKDVPELIILPVYSALPSEMQSRIFDPAP
PGKRKVVVATNIAEASLTIDGIFYVIDPGFAKQNVYNPKQGLDSLVITPISQASAKQRAG
RAGRTGPGKCYRLYTESAYRNEMSPTSIPEIQRINLGMTTLQMKAMGINDLLSFDFMDPP
SPQALISAMEQLYSLGALDEEGLLTKLGRKMAEFPLDPPLSKMLLASVDLGCSDEILTII
AMIQTQNIFYRPREKQAQADQKRAKFFQPEGDHLTLLAVYEAWKAKNFSGPWCFENFVQS
RSLRRAQDVRKQLLSIMDKYKLDVVSAGKNFTKIRRAIAAGYFFHAARKDPQEGYRTLVE
NQPVYIHPSSALFQRQPDWVIYHELVMTTKEYMREVTVIDPKWLVELAPRFYKAADPTKM
SKRKRQERIEPLYDRYHEPNSWRLSKRRA
NT seq 3510 nt NT seq  +upstreamnt  +downstreamnt
atggtggaatctgcggttgacaacggcgatgggctgaagaagctggagtacctatccctc
gtcaatcaggtctgtaccgagctcgaatcgaacctcggcgtcggcgacaaagtgctcgct
gagttcatcaccgacctcggccgcaaatccgagaccgtcgaagacttcgacaagaagctg
aaggagaacggagccgagatgcccgattacttcgtcaagactcttctcaccatcatccac
gctattctacctcccaaacccaaatccaagagcaaatccgatctcaagagccagtcttca
ggtctttttcatggcctcgcgaggcctgacgaccggcagcgggtgaagaatttgcaggag
gagattttgaaggaagctgaggagaaggctgatgcggaggcgagaaaccgagaagaagaa
gaccgtgatagacgccatcgagatcagcctcgtgatcgggatagagatcgggatcgtgat
agagacagaaggcataggagagatagggatagatatagaggtagaggcagcgatgacgaa
agggagagggatagatatagagggaggggcagcgatgatgaagggggtgatttcaatagc
agtagagaacaccctagaagaaattcggatgagccggagctttacagggtgtataaaggt
agggtttcacgagttatggacacgggttgctttgttcagataccggagttgagggggaaa
gagggattggttcatgtttcgcagattgctactagaagggttgtcaatgtgaaggaggtg
gtgaagagagatcaagaagtgtttgtaaaggtgatatctttttctggtcagaagcttggt
ttggcaatgagagatgttgatcagaagacaggaagggatttgcttccgataagaaaaact
tcggaggatgatgcattgagggcaaaccctttgagtggaaatagcaatggaccgacgaaa
aggatggggctatcagggattatgattactgaagaggatgagagcatgccggcaagaaga
aggccattgaagagaatgagctcgccggagaagtgggaggcaaagcagctgatagctgct
ggagttatggatgttagagattacccaaatttcgatgaggatggtgatggggttttgtat
caggaggaaggagctgaggaggagctcgaggttgagctcaatgaggatgagcctgcattt
ttgcaaggccagagtaggttttccatggatatgtcgccagtgaagatatttaagaatccc
gaaggttcgttgagcagagcagcggctttgcagtcagcccttattaaggaaaggagagag
gtgagagagcagcaacaacgaactatgttggattcaatcccaaaggatcttaacaggcca
tgggaagatccaatgcccgagacaggtgagaggcatctggctcaggagttgagaggtgtc
gggttatcagcgtatgacatgccggagtggaagaaggatgcttatggtaaagctttaact
ttcgggcagagatcgaagctttcaattcaagaacagaggcagagccttcctatttataag
ctgaagaaagagcttgtacaggctgtgcatgataaccaagttttggttgtaatcggggag
actggatcaggaaagactacacaagtgacacagtatttggccgaggctgggtatactaca
agagggaagatcgggtgtactcagcctcgtcgagtggctgcaatgtctgtagcaaagagg
gtggcagaggaatttgggtgtcggttaggagaggaagtcggttatgcgattaggttcgag
gattgcactgggccagaaactgtgatcaagtatatgacagatggtatgcttcttagggag
attttggttgatgaaaatctctctcagtattcagttgtaatgcttgacgaggctcatgag
aggacaatacacactgatgtgctttttgggttgttaaagcagcttgtacagcggaggcct
gacctaagattgattgttacttctgctacgctggatgcagaaaagttctcgggttatttt
ttcaattgtaatatctttaccattcctggcaggacctttcctgttgagatactttatgcg
aagcagccagagagcgattatctagatgcagcattgatcactgtgcttcagatacatctt
actgaacctgaaggtgacatccttctcttcttgactggtcaagaagaaattgatcatgct
tgtcaggctctttatgagaggatgaaaggcttaggtaaggatgtgcctgagttgataatt
ttgcctgtttacagtgctctacccagtgaaatgcagtccaggatttttgatcctgcacct
ccgggcaagaggaaagttgtagtggccaccaatatcgcagaagcatccttgactattgat
gggattttttatgttattgatcctggttttgcaaagcaaaatgtgtataatccaaagcaa
ggacttgattcacttgtgattactcctatttcgcaggcttcagcaaagcagcgagctggc
cgagctgggcgtactgggccagggaaatgctaccggctgtacactgagagtgcctaccgc
aatgagatgtcacccacctccattcctgaaattcaaaggattaatcttgggatgacaact
cttcaaatgaaagctatggggataaatgacttattatcttttgattttatggatccaccg
tcacctcaggcactgatatctgctatggagcagttgtacagtttgggagcattggatgaa
gaaggtcttctcacgaagttgggtagaaaaatggctgaattcccactggatccaccattg
tcaaagatgctcctggctagtgtagatttgggctgcagtgatgagatcttgacgattata
gcaatgatccagacacaaaatatcttctataggccaagggaaaaacaagcacaagcagat
caaaagagagccaagtttttccagccagaaggtgatcatttaacgctacttgctgtttat
gaggcctggaaagccaaaaatttttctggtccttggtgctttgaaaattttgtccagtcc
cgatcactaaggagggcgcaggatgtgaggaaacaacttcttagcatcatggataagtac
aagctagatgtcgtcagtgctggtaaaaatttcaccaaaataagaagagccattgcagct
gggtattttttccacgcagccagaaaggatccccaggagggctacagaaccctagtagag
aaccaaccagtatatattcacccgagcagcgctctattccagaggcagccagactgggtg
atatatcacgagctagtcatgactaccaaagagtatatgcgagaggtcacggttattgat
cctaaatggttggtggaattagcgccaagattttacaaggcggcggatccaacaaagatg
agcaagagaaagagacaagaaaggattgagcccctttatgaccggtatcatgagccaaat
tcatggaggcttagcaagcgtcgggcttga

DBGET integrated database retrieval system