KEGG   Aeropyrum pernix: APE_0150.1
Entry
APE_0150.1        CDS       T00023                                 
Symbol
nth
Name
(GenBank) endonuclease III
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
ape  Aeropyrum pernix
Pathway
ape03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    APE_0150.1 (nth)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_0150.1 (nth)
Enzymes [BR:ape01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     APE_0150.1 (nth)
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     APE_0150.1 (nth)
 Prokaryotic type
     APE_0150.1 (nth)
SSDB
Motif
Pfam: HhH-GPD HHH HHH_5 EndIII_4Fe-2S HHH_8 Transposase_20 Rtt106_N
Other DBs
NCBI-ProteinID: BAA79061
UniProt: Q9YFV0
Position
110845..111534
AA seq 229 aa
MGKGSIRDKISGEELLRLLRDNLRVDWREYVALVAYETDGNPFAVLAAVVLSQNTNDKNS
IRAYLKLRQTIGVTPEAILEASYDDLVEAIREAGLPRQKASALKALAEAVVRWGGENYLL
KAPPEELREKLMSIRGIGPKTADVFLSLVRKAPGVFAVDTHAARVARRWGLVGEKAGYDE
ISKALYNYFGPGNSEEAHRLIIALGRTYCKARRPRCRECPLRSVCPSAQ
NT seq 690 nt   +upstreamnt  +downstreamnt
ttgggcaagggttctatcagggataagataagcggtgaagagctgctgaggctactacgc
gacaacctcagggtagactggagggaatacgtggctctcgttgcttacgaaacggacggg
aaccctttcgcagtgctcgctgcagtagtgctaagccagaatactaacgataaaaacagt
ataagagcatatttgaagctccgtcagaccatcggagtcacgccagaagctatactggag
gccagctacgacgatctagtcgaggcaattagggaggctggccttcccaggcagaaggca
tctgctctcaaggctctcgccgaggctgtggttaggtggggcggtgagaattatcttctc
aaggcccctcccgaagagctgagggagaagctcatgtctatacgcggtatagggccgaaa
actgcagatgttttcctcagcctcgtcaggaaggcgcccggtgtttttgcggtggacacc
catgcggccagagtcgcgaggagatggggcctagtgggtgagaaggcggggtatgatgaa
atatccaaagctctctacaactatttcgggccgggtaatagtgaagaggcacacaggctt
atcatagccctaggccgaacttactgtaaagctaggaggccgaggtgcagggagtgtcct
ctgaggagcgtatgtccgagtgcccagtag

DBGET integrated database retrieval system