KEGG   Aeropyrum pernix: APE_0322.1
Entry
APE_0322.1        CDS       T00023                                 
Name
(GenBank) putative DNA repair helicase Rad3
  KO
K10844  DNA excision repair protein ERCC-2 [EC:5.6.2.3]
Organism
ape  Aeropyrum pernix
Pathway
ape03022  Basal transcription factors
ape03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ape00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    APE_0322.1
  09124 Replication and repair
   03420 Nucleotide excision repair
    APE_0322.1
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ape03021]
    APE_0322.1
   03400 DNA repair and recombination proteins [BR:ape03400]
    APE_0322.1
Enzymes [BR:ape01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     APE_0322.1
Transcription machinery [BR:ape03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     APE_0322.1
DNA repair and recombination proteins [BR:ape03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     APE_0322.1
SSDB
Motif
Pfam: Helicase_C_2 DEAD_2 HBB DEAD ResIII
Other DBs
NCBI-ProteinID: BAA79277
UniProt: Q9YFB9
Position
complement(233796..235661)
AA seq 621 aa
MSGGSIVFPYGSWRKGQRELAEEVRRSVSEGELLLASAPTGFGKTAAVIYGLLSAGAERV
LYLVRTVNEIDPVVRELKRFGARFTFLFSARRMCPLMTAEGSLPSVEDFWGNCRIARAKG
VCSYYEELSRLDEAEVAQYVRSRPVISAYRLAWDIAKFKGACPFFALKGLVEDSQFIVAT
YPYLFKEDIFRSFLEPYDYGDFVAVVDEAHSLLNIHSLHEYRVSQRDLDLALKEVREYAS
SARDFIAWLESVLKKASRLKVSRITLLDKQPFLEGLDDLSVVEDVVETIRARKAEEALSL
SGPSGIGRVKTMASRIYSWLSVLVRDDSYLFAEKDEGGVLWLIATPLDPSRVVKEPLEKV
KAAVLLSGTMPSTKLYMEVLGVSRSFKFVDVNLMYGARGFGRFFTIVAADVTTAYRSRGD
SMYRLIASRIAMADRLLPGLKLAVYPSYEVMYRVVERLPADVETIVETRGISLDEVEAKI
LARDPGEKIIINAVAGGKLVEGVEFVDYEGRNLLSTVIVVGVPFPQPDDYTRKHLEVMAS
RIGVSNARKLVYLVNPMIKVRQALGRGIRGPEDRALYILMDYRYLRRDLKEVLGMPYHRV
VKGAEDFEEAVKAARSRVFGG
NT seq 1866 nt   +upstreamnt  +downstreamnt
ttgtccggcgggagcatcgtcttcccctatggcagttggaggaaggggcagagggagctg
gcggaggaggttaggaggtctgtatctgaaggtgagctacttctggcgagcgcccccacg
gggttcggcaagaccgctgcggtcatatacggcctcctgtcggcgggtgctgagagggtt
ctctatcttgtccggactgtcaacgagattgaccctgtggtgagggagctgaagaggttt
ggggctaggtttactttcttgtttagtgctaggcgtatgtgccctcttatgacggctgag
ggctcgctgccgtctgtcgaggatttttggggtaactgtaggatagccagggctaaaggc
gtgtgcagctattacgaggagctgtctaggctggacgaggctgaggttgcccagtatgtg
aggagccgtcctgtgataagcgcttacaggctggcatgggatattgcgaagttcaagggc
gcctgccccttcttcgcgttgaaggggctcgttgaggatagccagttcattgtggcgact
tacccctacctcttcaaggaagacatcttcagatctttcctcgagccctacgactatgga
gacttcgtggctgttgtggacgaggcccacagtctcctcaacatacacagcctccatgaa
tacagggtgtctcagagggacttggatcttgctctcaaagaggttagggagtatgcctcc
tcggcgagggatttcatcgcgtggctcgagagcgtcttgaaaaaggcctcacgcttgaaa
gtatcgaggataacccttctggataagcagcccttcctggaggggcttgacgatctctct
gtagtggaggatgtagtcgagactataagggccaggaaggctgaggaggcgttgtctctc
tcaggcccctcgggtattgggagggttaaaacgatggcctccaggatatactcctggctc
tctgtcctggtgagggacgactcgtacctcttcgccgagaaggacgagggcggggtgcta
tggcttatagctacgcctctcgacccctccagggttgtcaaggagccgctcgagaaggtg
aaggctgccgtcctcctgagtggaaccatgccgtctaccaaactgtacatggaggtcctg
ggggtctcaaggagcttcaagtttgtcgacgtcaatcttatgtacggcgcccggggcttc
ggaaggttcttcacgatagtcgcggctgacgttacgactgcatacaggtctcggggggat
tctatgtataggcttatcgcctcaaggatagcaatggctgataggctgctacccggcctc
aagcttgcagtgtacccgagctacgaggtcatgtacagggttgttgagaggctgccagcg
gatgtggagactatagttgagactaggggcatcagcctggacgaggtcgaggcgaaaatc
ctcgctagagatcctggggagaagattatcataaacgctgtggctggcggcaagcttgtg
gagggcgttgagttcgtggactatgaggggaggaacctgctctcgactgttatcgtggtg
ggcgtcccgttcccgcagcctgatgactacactaggaagcacttggaggttatggcgtcc
aggattggggtttccaacgctaggaagctggtgtaccttgttaatccgatgataaaggtt
agacaggctcttgggaggggtattagagggcccgaggacagggctctctacatactaatg
gactatagatacttgaggagagatctaaaggaggtcctgggaatgccctaccaccgtgtt
gtcaagggtgccgaggacttcgaggaggctgtaaaagctgccagatctagggttttcggc
ggctag

DBGET integrated database retrieval system