KEGG   Acyrthosiphon pisum (pea aphid): 100162163
Entry
100162163         CDS       T01076                                 
Name
(RefSeq) esterase E4-like
Organism
api  Acyrthosiphon pisum (pea aphid)
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 100162163
NCBI-ProteinID: XP_001947304
APHIDBASE: ACYPI003333
UniProt: J9JSN2
Position
A1:complement(129194256..129199287)
AA seq 560 aa
MHRIVLAVFVLLFQYVFCTGPLINVHEGQLKGKQFLSRNGRNFFAFQGIPYAKPPVGQLR
FKAPEPISPWKGVLNATSEPSMCIQKNLFMYQTSDVLMGSEDCLYLNVYTPKLPKTGVKN
LPVMVWIPGGGFSSGHGGMRLYGPKFLMDKDIVLVTINYRIGILGFLSTEDDILPGNYGL
KDQVVALRWVQDNIAKFGGDSKKVTLFGESAGGASVGLHLLSPLSKGLFHKAIIQSGSPF
CQWAVLPPGLAERRAKAVATITGCPSNSKDMIDCLRLLPADTFVQLNRNFFEWEVHPSVT
FSAVVEKCHEKKDSFLCNYPLKYYKQESLVPIIIGMNSGEGGFFASRLYNENGLIYPEFK
ENFRRIVPLMLLYHFTASYKDVGLISDKLKEHYFPEGTSIEDNPKKTVDMVTGGIFLKGV
IDMANHVMSPVHFYVYDYVNKHSLNAFFGPCPKHLGVTHGDEMISLFDLGKRLNTQDESV
SKLMVDIWTNFASSDKLTVDGKNTGNTWPRYNKKDMKYLLIKSSTPVLSERPFMDEYNFW
SGLPLTPSVNYSRENSRTEL
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcatcgaattgtgttggctgtttttgtgttacttttccaatatgtcttttgtaccggt
ccactgattaacgtacacgaaggccaattgaaaggaaaacagttcttgtcgagaaatgga
cggaatttttttgcgtttcaaggaataccgtatgcaaaaccacctgtgggacagctccgg
ttcaaagctcctgaacctattagtccctggaaaggcgtattgaatgctacatcggagccg
tcaatgtgtattcaaaagaatctgttcatgtaccagacatccgatgtcctcatgggcagt
gaagattgcctatatttaaacgtttatacaccaaagctgcccaaaacaggtgtgaaaaat
ttacctgtcatggtatggatcccaggaggaggttttagctcgggacatggtggtatgcgt
ctctatggccctaagtttctaatggataaggacattgttttggttacaatcaattacagg
atcggaattctcggttttttgagcactgaagatgatatattgccgggaaattatggtttg
aaagatcaagtagtagcacttcgttgggtgcaagataatatcgccaaatttggcggcgat
agtaaaaaagttacgttattcggtgagagtgcaggaggggcaagtgtgggattgcattta
ctgtcaccattaagtaaaggactatttcacaaagcaattatacaaagtggaagtcccttt
tgtcaatgggccgtcttgccaccgggcttagccgagcggcgtgccaaagctgttgctaca
attactggatgtccctccaattcaaaagatatgattgactgtttaaggcttttacccgcc
gacacatttgtgcaattgaatagaaatttttttgaatgggaagtacatccatcagtcacc
ttttcagccgttgttgaaaagtgtcacgagaaaaaagattcgtttttatgcaattatcct
ttaaaatattataaacaagaatcactcgtgccgattataattggaatgaattctggagaa
ggtggtttttttgcatctcggctttataatgaaaatggtcttatctaccctgaatttaaa
gaaaacttcagacgaatagtgcctctaatgctactttaccatttcaccgcttcatacaaa
gacgttggtcttattagtgataaattgaaagaacattactttccagaaggaacttcgatc
gaagacaatcccaaaaagacggttgatatggtcactggtggcatattcttaaaaggggtt
attgacatggctaatcatgtaatgtcacctgtacacttttatgtatacgattatgtaaat
aagcattcattaaatgcattcttcggaccatgtccaaaacatttaggtgtcactcacggc
gatgaaatgattagcctttttgacttaggcaagcggttaaacacacaagacgagagtgtg
tctaaacttatggtagacatttggacgaacttcgccagctctgataagttgactgttgac
ggaaaaaacacaggaaatacttggccgaggtataacaaaaaggacatgaaatatttatta
ataaaatcatctacgcctgttttgtccgaaagaccgtttatggacgagtacaacttttgg
agcggactaccactgacgcctagtgtcaactacagtcgagaaaattccagaacggaactt
taa

DBGET integrated database retrieval system