KEGG   Acyrthosiphon pisum (pea aphid): 100162957
Entry
100162957         CDS       T01076                                 
Name
(RefSeq) LOW QUALITY PROTEIN: low-density lipoprotein receptor-related protein 1
  KO
K04550  low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
api  Acyrthosiphon pisum (pea aphid)
Brite
KEGG Orthology (KO) [BR:api00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:api04131]
    100162957
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:api04090]
    100162957
Membrane trafficking [BR:api04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    100162957
CD molecules [BR:api04090]
 Proteins
  100162957
SSDB
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition SGL cEGF EGF EGF_3
Other DBs
NCBI-GeneID: 100162957
NCBI-ProteinID: XP_029343493
APHIDBASE: ACYPI004075
Position
A1:complement(3253188..3298506)
AA seq 4707 aa
MIQRFCLLGILIFFNKPSATSTFDDSIDGKPISSCNSNQFFCGSGECIPLKWKCDFNPDC
ADGSDEFDSCGLPTCKYSQFQCALSKKCIPREWICDGELDCGASLNSTEQDASDEDSLQC
QKPSSCPPNMARCGNSTQCKYIESFCDGTSHCENSTDEGRFCENMVPCHGLNCAHGCKPT
GKGPACFCPEGMQPHNNECIDMDECEVLNYTCDQICTNKKGSFSCSCVPGYIQTNSTCKA
INVPENEDASILVSTSKDIRRIYLNGSSYAGQRCNVQALSLTFDHRNHTVCFVHQYNKTN
GAKLSCANIDNLSVSDIWDLPPPTFFPLLATTHVALDWVSRNWYYVDDDRDMIYMCTYNM
KYCQILIDVNLNKPRSIALDPTKGFMFFTKWGQYPAMVERAQLSGLDRVPLIDHKIVYPY
GLTVDIPSEHIYWVDTYLDFVERINYDGSNRRTIKKGYPVINLYDISVFENHMYVTSWRL
QSVIKLNKFNGSYYESLITNLSRPFTIHVYHRQEQPEINHPCMINNGGCDHICVTAYKNK
EAIAQCLCQPGYRLTSGKCISSKLPAFLIFGKSSPPMIKGISMISKNHKQQIILPLDEGR
IPTTIDYDVKTQSIYYSGGKKNAIERIRLNGTKKELVKMLPEMNCEGLAIDWTGRNLFWT
DEGLGTVNVFKIDDPTKQKVLITNRVYHPRSIVLDPKNGFMYWGNWPRGSTSTGGSIERA
WMDGNNQTTFVNVDVQWPMSLTLDFFTRKLYWSDVYKDRIECIDLDGSNREIIKRSTPYP
YGIAIYNNLLFWTETATTEVLIKSYNLINKSQETLGIENPPLYTLKVYNSEAQVKASPYW
CEKLDLCPGLCMSTPNGPVCMCNDGYVLRTTDDKKKECIKSSNYSTPNACGDDEFQCIKN
KQCISKKYVCDGDNDCGDGSDEDTSEYGPCGKHTCPQENFACSDSNKCISKFWVCDGDND
CDDKSDESPGLCESCLASQFSCSVTKRCIPHSWVCDGTFDCGEGDTSDEHQYCETRTCQE
LEFTCTNGHCISYEYVCNAEDNCGDGSDEVKCSDCVGEFLCTKNNTCIPLKKKCDGVIDC
DGATDEFNCSSGLNHTNYTCSNDEFLCLNTTGFCIDKHYVCDGLPDCPNGSDENNCTTIK
NCTLENCHSHEIDNSSSIFCAYPNITCDHKRTCISVDMLCNGKNDCLDGSDEGGQCASNE
CELSSDCSHICQNSPDGYICLCPPNMILQNDNTTCSVVSPCSTWGRCSQKCMKLGHYGHK
CTCNEGYLLATDHFTCKSIDTNIPQIIFSNKHELRGIDLVTRNVKSLISHLKNTVTLDFY
HAKDGTDTLYWTDVMDDKIFKGKIIGGSLSDIEVVVQSGLTTAEGLAVDWVAGNIYWVES
NLDQIEVAKLNGSYRRTLIAGDMESPRAIALDPRYGYLFWTDWDSSAPRIERCSMAGEFR
QTIVLVSMFSDGEWPNGLTLDYELNRIYWIDAKSDTIHTVDYNGNNHHLVLKGHELLSHS
FAITLFENDVYWTDWRSNSVNKANKWTGLNVTVVQHTVTQPFDIKILHPSRQPKVEFNPC
GTNNGNCSHLCLLNINSKYKCDCPHVMQLSKDNHTCIENEIVLLFAQLNEIRGVNLEQPY
YNTIPTLLSYDSQALLHVQIDYLAADKKIYWSDYSSNEIKRSNLSGGNIEVILDTGIHQP
HGFAIDWMSKNMFIAVSSDQNPLTEEKISGARTIIACNLDGEYFTTIYSSDWTDEDTNKT
LQIGALAVHPQQGKLFWTQGMSSGHHNIIMSNMNASSYSIIYTEKIIPFVSGFTSLTIDQ
ETNTLYWVNSDKHSIQSYSIQDSRINPSLNLPEEGFPSSIALYKNNIYYVDNRLMNIRVA
NKITGDENSNFRNITADVYALSLYDQSLQMGINYCSKNRGMCSHLCLPTSADHWVCRCAI
GYTIDPKDKKKCIGVSEFLLFTVESEIKGISLVKNDSRQVLSPLSKTSMAYSIDFHGEYI
YWSDDEQGTIMRIKRDGTGRQIIVNHEHSSDTNSGAWVSGIAIDWIAGHIYWANPSLNII
QVAYLNGSNAYVVVDSGDDTMERPNSLAVDPVAGFIFWSIRRHHGVSRATLDGMNKKSIL
LNKDQPYVEDITLDYTIVTPASVVVHNGYIYWLGIMQVQGSSSIMVSPINNLSASEELTR
EFGEHPKDVQIFSKSRHQGSNICSKHNGGCQELCLFNGTHGVCACTHGIVGSDGKKCEDY
TTFLMYSRMDKIDSVSISENPNLKTPFRVMESKTFMQNIIALSYDYARSLLFYSDIQRGT
IDAIHFNNTGHRVIAENQGSVEGIDYEMSENILYWTNDRASISRLNLSQPDAVPEIVLKL
GESDRPRGIAIDICEILIFWTNWNNLKPSIQKSYVNGFMLQSIITTDIQIPNALTIDHTT
HKLYWGDAKLDKIERCEYDGTNRVVLAEMYPQHPFDIAVYGDYFFWTDWMLNAVLRADKY
TGENIAWIRKDVLRPMGIVAVAENISDCNRNPCRLLNGRCEDICSLDIKGAVECSCFNNR
TLLPDKHRCVENKLKNNCSNNEFWCSSNECIPFENTCDGINHCLDESDEDLKYCVTRSCP
EGFFSCPDFKQCRPNSKKCDGIFDCLDGFDEIECSCKNASFFRCKSGECIAPNLRCDLDP
DCSDASDEIGCDIKICEDLIFNATIISCNTTTACIHPNWICDGQNDCWDNSDEQNCSSIK
HLATEKNNCSSADFKCSNGKCISKSWKCDGDDDCGDSLNTSLPSSDEMNCPIKCKSTEFH
CKTKFGTYECLPASWQCDGSPDCLDGSDEPINCLSRKFSSSDFHCNQTGRCIPSTWVCDK
DDDCGDSSDENEEICVVNNSTCPITKFECVNKKCIFEAYYCDGHDDCGDNSDEPENCKVC
DSVKEFMCENGACILLTDVCNGKNDCGDNSDENFHTEVCKHYKNESCSWPDNFFCHNKIC
INANLTCNGQDDCGDFSDEDKCNINECALESITQIFRPCEHICIDRPVGYECKCHPGYKS
VGTLCHDINECNSTEITKPCNQICHNTIGSYKCDCTAGYTLLRDGFSCKASTIEKPMLIF
ANKHNIKQIDLRGMAIEIVVDNLTNAVAVDYDYADSCFYWSDISNQGSTIKRKCKDTASE
RLHGPLIKSSDGIAVDWVAKNLYWCDKGKDTIEVSKLNGQFRKVLISKSLQERRAISLDP
IRGYMYWTDWGDVPYIGKAGMDGSEPKAILNESLGWPNALVISLATEELFWADAKEDYIA
YSDLNGNNRHFIMSRKIDPYVNIHHVFAITLFENFVYWSDWETKSIHKCHIYSGQECRNV
TSLAYRPMDIKVVHPLLQPSRAYNPCEKNNGGCKGLCLLSPNLGRTCACPQDFILAPDNM
NCIANCSSSHFVCANTFKCIPFWWHCDKHDDCGDGSDEPDTCLDFLCTPGQFQCKNHQCI
QPSQICNGIFDCKDNSDEENCGNYTCLDTDFKCQHGSKFSKLPMPTCISNQLKCNGRNDC
LDGEDEKDCKSKTCGAKEFKCEITGKCIPNVFMCDGEYDCGFGDNSDEPENCTSRSCSSD
EVRCKNGRCIHSTWMCDGENDCPDMDDEPPSCYNITCDPTYFKCANGKCIPGRWRCDNEN
DCGDKSDEIGCSPRNCSEHEFRCSDGRCILTSQKCDGKINCSDNSDEDDCDSHVTCGSDD
FHCNGSYHCISPTWRCDGDQDCPDGSDEWNCTDKLGKGCSISRNGQFVCKNGDCISLGNR
CDGEEDCADGSDENRTMCALVACPPGKYRCDNHNCVFNTNVCDGLDHCGDGSDENKVACA
SASEICDSSKFRCANGLCINRHLRCNGFFDCPDNSDEQLCNVTKTSCQFGTCSQICVPKK
NSTHSCHCASGYSITLPNKSCQAIGTPALLVVANNEGDIFFVDPYKSHENLFKYSAVTIP
SHKIHSIDILWTINATYLFWSDHNSKALYSTIIDKSNRTTRDVNTAKKIIQTIGTPESIA
VDWVANNLYWIETSDRTKVIKVATLDGKNIRTLVKLETDRKPQNIVLDPQSGTMYWTDLG
RKPRIETCSMDGYNRRTFISESVRSPAGITIDYAARRLYWSDTKPYTIESVLLDGKGRKV
IHKFPKGKHPTNIELFEDSIYVSLMTTIVKIDKFENKNITTLSKNIFRATDLVIMQENKH
PKDLNNFCLINPCHHTALCTLSMNPKNRTCMCADDQVEVPTLTDDIKCVDKQTPPLICDP
SCDMGECVLNVTSELGYCKCNPFFGGETCNEYECHKYCHNKASCYVFHEDILEESKLKVL
VYVLFIGPVIDVIFLYLQKCCPKGGNCLNGGICIDNICDCMPGFTGEFCEKCVNVDCKNG
GVCVLTDSGHGECKCPAGYMGPTCTKSDCDNYCIKGTCFLDSNGPICKCHEGYTGPHCEF
DKCDNNNCLNGGSCYIKDNITACLCLPQFKGPSCRIDICNCTCDKNDHECHIYCPPNRKY
PLCDQINSTTNLCHPEMCKNGGTCIIVDGLPACRCVGLWGSSDCSNIIVDSGSCLGYCYN
NGTCYMESNSGVNEPNCKCSSGWTGSRCADRFTCANYCINGGTCIEPEESIGSLSCHCQK
GYIGDRCQTQLIDEYMSSEHQNKHSINALWVIFLIIVLSIVITATTYYFTKLRRRGRSFS
HVRMQENSEVNNPMYIQDDIDDEDVHLDRSFPLQEKPSGHFGNPVYDSVYSASSSASVTG
SEESKGLLQSTNLTNQILTPENSHDET
NT seq 14124 nt   +upstreamnt  +downstreamnt
atgatacagcggttttgtttgttggggattttgattttcttcaacaaaccatcggcaaca
agtacattcgacgattccatcgatggaaaaccaatcagctcttgtaattcaaatcaattt
ttttgtggttctggagaatgtatacctttaaaatggaaatgtgactttaatcctgattgt
gctgatggttctgatgaatttgattcatgtggtcttccaacatgcaagtattctcagttc
caatgtgcattatcaaaaaaatgtataccacgagaatggatatgtgatggtgaacttgat
tgtggtgcttctttaaattctacagaacaagatgcatctgatgaggactcattgcaatgt
caaaaacctagtagttgtcctccaaacatggcaagatgtggaaattcaacccaatgtaaa
tatattgaatctttttgtgatggcacttctcattgtgaaaatagtactgatgaaggaaga
ttttgtgaaaatatggttccatgccacggtttaaattgtgcacacggatgtaaaccaact
ggaaaaggtccagcttgtttttgtcctgaaggaatgcaacctcataataatgaatgtata
gatatggatgaatgtgaagttttaaattatacttgtgatcaaatatgtactaataaaaaa
ggatcatttagttgtagttgtgttcctggttatattcaaacgaattcaacatgtaaagct
attaatgttcctgaaaatgaagatgcatcaatacttgttagtacttctaaagatattcga
agaatataccttaatggaagttcttatgctggccaaagatgtaatgttcaagcactttct
ctgacatttgatcatagaaaccatacagtatgttttgtgcatcaatacaataaaacaaat
ggagctaaattgagttgtgctaatattgataatctttccgtgtcggacatttgggattta
cctccacctacattttttccattattagcaactactcatgtggcattagattgggtatca
aggaactggtattatgttgatgatgatcgagatatgatctatatgtgtacttataatatg
aaatattgtcaaattttgattgatgttaatttgaataaacctagaagtattgctttggat
ccaaccaaaggatttatgttttttacaaaatggggacaatatcctgcaatggtagaaaga
gctcaactttcaggtcttgatagagtacctttgatagatcacaaaatagtttatccatat
ggacttactgtagatattccatcagaacatatttattgggtagatacttacttagatttt
gtcgaaagaatcaattatgatggatctaatcggcgtacaataaaaaaaggatatcctgtt
ataaatttatacgatatatctgtgtttgaaaatcatatgtatgtaacatcttggagatta
caaagtgttataaaacttaataaatttaatggcagttattatgaatcgttgatcacaaac
ttaagtcggccattcacaattcatgtatatcacagacaagaacaacctgaaattaatcac
ccttgtatgatcaataatggaggttgtgaccatatttgtgttactgcttataaaaataaa
gaagctattgctcaatgtttatgtcaacctggttatagacttacttctggaaaatgcatt
tcatccaaattgcctgcatttttgatatttggaaaaagtagtccaccaatgattaaaggc
atatccatgatctcaaaaaatcataaacaacaaattattttaccattagacgaaggcaga
atacctacaactattgattatgatgtcaaaacacaatcaatatattattcaggaggaaaa
aaaaatgcaattgaacgaataagattgaatggaacaaagaaagaattagtaaaaatgtta
ccagaaatgaattgtgaaggtttagctattgactggactggtcgtaatttattttggaca
gatgaaggtttgggtacagttaacgtgtttaaaattgatgatccaactaaacaaaaagta
ttgataaccaatagagtttatcatcctagatcaattgtacttgatcctaaaaatgggttt
atgtactggggaaattggcctcgaggctctaccagcacaggtggcagtattgagagagct
tggatggatggaaataaccaaacaacctttgttaatgtggatgttcaatggccaatgagc
ttaaccttagacttttttactagaaagttgtactggtcagatgtttacaaggataggata
gaatgtattgatttggatggtagtaacagagaaattattaaacgatcaactccttatcca
tatggaattgctatatataataatttattattttggactgaaactgctactacggaagta
ttgataaaaagctataatttaataaacaaatctcaagaaacattaggaattgaaaatcct
ccactttatacattaaaagtgtataatagtgaagctcaagtcaaagcgtctccatattgg
tgtgaaaaattagatttatgtcctggattatgtatgtctactcccaatggaccagtttgt
atgtgcaatgatggttatgtattgagaacaactgatgataaaaaaaaagaatgcatcaag
tctagtaattattctacacctaatgcctgtggagatgatgaatttcaatgtattaaaaat
aaacaatgtatatcaaagaaatatgtatgtgatggagacaatgattgtggagatggttct
gacgaagacacttcagaatatggcccttgtggaaaacatacttgtcctcaagaaaacttt
gcatgtagtgatagtaataaatgtatatcaaaattctgggtgtgcgatggtgataatgat
tgtgatgataaatctgatgagagtcctggattatgtgaatcatgcttagcttcacaattt
tcatgttcagttactaaacgctgtatccctcattcctgggtttgcgatggcacatttgat
tgtggggaaggagacacatcagacgaacatcaatattgtgaaacacgcacatgtcaagaa
cttgagtttacatgtacaaatggacattgtatatcttatgaatatgtttgcaatgcagaa
gataattgtggtgatggttcagatgaagtaaaatgttctgattgtgttggtgaatttctt
tgtacaaaaaacaatacatgcatacctttaaaaaaaaaatgtgatggagttattgattgc
gatggagcaacagatgaattcaattgtagtagtggattgaaccatactaactatacctgc
tcaaatgatgagtttttatgtttaaataccactggtttttgtattgataaacattatgtt
tgcgatggattacctgattgtcctaatggtagtgatgaaaataattgcactacaattaaa
aattgtactcttgaaaattgtcattctcatgaaatcgataattcatcttcaatattttgt
gcatatccaaatattacttgtgaccataagagaacgtgtatttctgtagacatgttatgc
aatggtaaaaatgattgtttagatggttcagatgaaggtggacaatgtgcttcaaatgaa
tgtgagttatcatctgattgttcacatatttgtcaaaatagtcctgatggctacatatgt
ttatgtcctcccaacatgattcttcaaaatgataatacaacatgttcagtggtgagtcct
tgtagtacttggggacgttgttctcaaaaatgtatgaagcttggtcactatggacataaa
tgcacttgcaatgaaggatatttactagccacagatcattttacttgtaaaagtatagat
actaatatacctcaaataatatttagtaataaacacgaattacgaggaattgacctagtt
acaagaaatgtcaaatcattaatttctcatttgaaaaacactgttacattggatttttat
catgctaaggatggaactgataccctatattggactgatgtaatggatgataaaatattt
aaaggaaaaataattggtggatcattgagtgacatagaagtagtagttcaaagtggtctt
actacagctgaaggtcttgctgttgattgggtagctggaaatatttattgggttgagagt
aatttagatcaaattgaagtggctaaattaaatggaagttatcgaaggactttaattgct
ggggacatggaaagtcctagggctattgcattagatccaagatatggttatttattttgg
acagattgggattcatcagcaccccgaattgagcgatgcagtatggctggagaatttcgc
caaactattgtacttgtaagcatgttttctgatggggaatggccaaatggattaacttta
gattatgaactaaatcgtatctattggattgatgccaaatcagatacaatacatacagta
gattataacggcaataatcatcatctcgtattaaagggacatgagcttctttcacattca
tttgctattactctctttgaaaatgatgtgtattggactgattggagaagtaattcagtg
aataaagctaataaatggactggtttgaatgttactgttgtgcaacatactgttacccag
ccatttgatataaaaatattgcaccctagccgacaaccaaaagttgaatttaacccttgt
ggaacaaataatggaaattgctcacatttgtgtttattgaatataaattctaaatataaa
tgtgattgtccacatgttatgcaattatccaaggacaatcatacatgcattgaaaatgaa
attgttttattatttgcacaacttaatgaaattcgaggtgttaatttagaacaaccatat
tataatacaattccaacattattgtcttatgattcacaagctttgctgcatgtacaaata
gattatttggctgcagataagaaaatttactggtctgattattcaagtaacgaaattaaa
agatctaacttatctggtggcaacattgaagtaattttagatacaggaattcatcaacca
catggttttgctattgattggatgtcaaaaaatatgttcattgcagttagttctgatcaa
aatcctcttacagaggaaaaaatctctggtgccagaactataatagcctgtaatctcgat
ggagagtattttactaccatatattctagtgattggactgatgaagatacaaataaaact
ctacaaataggtgcattagctgtacatccacaacaaggcaaattgttttggacacaagga
atgtcaagtggccatcataatattataatgtccaatatgaatgcatcttcttattccatc
atttatacagaaaaaataataccttttgtatcaggttttaccagcttaactattgatcag
gaaacaaatacactttattgggttaattctgataaacattctatacagtcttatagtata
caagactccagaataaatccttctttaaatttaccagaagaaggttttccatcatctatt
gctttatataaaaataatatatactatgtggataacagattaatgaatattcgagttgca
aacaaaattactggagatgaaaattcaaattttcgcaacataactgcagatgtgtatgca
ttgagtctgtatgatcaatctttacaaatgggtattaactattgttcaaaaaatagagga
atgtgctctcatctttgcttacctacttctgctgatcattgggtttgccgttgtgctatt
ggatatacaattgatccaaaagataagaaaaaatgtattggtgtcagtgaatttttacta
ttcactgtggagtctgaaatcaaaggcatatctttagtaaaaaatgattcaagacaagtt
ctaagtccattatctaaaacatcaatggcatatagcatagattttcatggagaatatata
tactggtcagacgatgagcaaggaactatcatgagaataaaacgtgatggaactggtcgg
caaataattgtaaatcatgaacattctagtgatacaaattcaggtgcttgggtatcagga
attgctattgattggatcgctggtcatatttattgggcaaatccgtctttaaatattatt
caagtggcttatcttaatggatctaatgcttatgtggtggtagatagtggagacgacacc
atggagaggcctaattctttggctgtggatcctgttgctggttttatattttggagtatt
agacgtcatcatggagtctcaagagcaactttagatggaatgaataaaaagagtatttta
ctcaataaagatcaaccatatgtcgaagatatcacattggattacacgatagtaacccct
gctagtgttgttgtacataatggttatatttattggcttggaattatgcaagtacaaggg
tcatcatcgataatggtttcacctattaataatttatctgcatccgaggaattaacacga
gaatttggagaacatccaaaagatgttcaaatattttcaaaaagtcgtcatcaaggatct
aatatttgttctaaacataatggaggatgtcaagaactatgtttatttaatgggactcat
ggggtttgtgcttgtacacacggtattgttggatctgatgggaagaaatgtgaagattat
actacatttcttatgtattctcgaatggataaaattgatagtgtttctatatctgaaaat
ccaaatttgaagacaccatttagagtcatggaatcaaaaacttttatgcagaatataatt
gcattgtcatatgattatgcacgttctttattattttactcagatattcaacgtggaact
attgatgctattcattttaataatacaggccatagagtaattgcagaaaatcaagggtct
gtagaaggtattgattatgaaatgagtgaaaatatattgtactggacaaacgatcgtgca
tctataagtcgattaaatctaagccaaccagatgctgttcctgaaatagttttaaaatta
ggagaatcagatcgaccacgtggcatagcaattgatatctgtgagatactgatattttgg
accaattggaataatttaaaacccagcattcaaaaatcttatgttaatggatttatgcta
cagtcaattataacaactgatattcagattcctaatgctcttacaatagatcatacaact
cataaactatattggggtgatgcaaagttggataaaattgagcgatgtgaatatgatgga
acaaaccgcgtggtacttgctgagatgtatccacaacatccatttgacattgctgtttat
ggtgattattttttttggactgattggatgttaaatgcagttttacgagctgacaaatac
accggtgaaaatattgcatggataagaaaagatgtcttacgacctatgggaatagtcgca
gttgctgaaaatattagtgattgtaatagaaacccatgcagattactcaatggacggtgt
gaagatatatgcagtttggatattaaaggtgctgtagaatgttcttgttttaacaaccgt
acactcctacctgataaacatagatgtgttgaaaacaaattaaaaaataattgttcaaat
aatgaattttggtgttcgtctaatgaatgtataccttttgaaaacacttgtgatggtata
aaccattgtcttgatgaatctgatgaagacttaaaatattgtgtcacaaggtcttgtcca
gaaggatttttctcgtgcccagatttcaagcaatgtcgtccaaatagcaaaaaatgtgat
ggcatttttgattgcttggatggttttgacgaaatagaatgttcttgtaaaaatgcttct
tttttccgttgtaagtctggtgaatgtatagctcccaatttacgttgtgatctagatcct
gactgcagtgacgcaagtgatgaaattggttgtgatatcaagatttgtgaagatttaata
tttaatgctacaataataagctgtaatacaactactgcttgtatccatccaaattggatt
tgtgatggtcaaaacgattgttgggataacagcgatgaacaaaattgctcatcaatcaaa
catctagctactgaaaaaaataattgctcatctgctgattttaaatgttcaaatggtaaa
tgtatttctaaatcatggaaatgtgatggtgatgatgattgtggcgattcattaaatacc
tcattgccttcatcagatgagatgaattgccctattaaatgtaaatcaactgaatttcat
tgcaagaccaaatttggaacttacgagtgtttaccagcatcatggcaatgtgatggatct
ccggattgcttggatggttctgatgaaccaataaattgcttgagtagaaaattttcaagt
agtgattttcattgtaatcaaactgggcgatgtataccatctacctgggtatgtgacaag
gatgatgattgtggtgatagttctgatgagaatgaagaaatatgtgtagtaaacaattca
acttgtcctataactaagtttgaatgcgttaataaaaaatgcatttttgaggcatattat
tgtgatggtcatgatgactgcggggacaattcagatgaacctgaaaactgtaaggtatgt
gattctgttaaagaatttatgtgtgaaaatggtgcttgcatcttactaactgacgtatgc
aatggtaaaaatgattgtggtgacaattctgatgagaattttcacactgaagtgtgtaaa
cattataaaaatgaaagttgttcatggcctgataatttcttttgccataataaaatatgt
atcaatgcaaatcttacctgtaatggacaagatgactgtggagattttagtgatgaagac
aagtgtaatattaatgaatgtgcactagaatctattactcaaatctttcgtccttgtgag
catatatgcatagatcgtcctgttggctatgaatgtaaatgccatcctggctataagtct
gtgggtaccttatgccacgacattaacgaatgcaattctactgaaataacaaaaccttgt
aaccaaatatgtcacaacaccatagggtcttataaatgtgactgtactgcaggttataca
ttattacgagatggtttttcatgcaaagcttcaacaattgagaagccaatgcttattttt
gctaataaacacaatataaaacaaattgatttgcgaggaatggcaattgaaattgtagtg
gacaatttaactaatgctgttgcggttgattatgattatgctgatagttgtttctattgg
tctgacatatccaatcaaggtagcacaattaaacgaaaatgcaaagacacggcttctgag
agattacatggcccactgataaaaagttctgatggtattgcggtggactgggttgctaaa
aacttatactggtgtgacaagggtaaagacacaatcgaagtgtctaagttaaatggtcag
tttagaaaagtattgataagtaaaagcttacaagaacgtagggccatcagtttagatcct
attcgaggatatatgtattggactgattggggggacgtgccttatattggtaaggctgga
atggatggtagcgaacctaaagctattttaaatgaatctcttggttggccaaatgcctta
gtaataagcttagctacagaagaacttttttgggctgatgcaaaagaggactatatagct
tattctgacttaaatggaaacaatagacatttcattatgagcagaaaaattgacccttat
gttaatatacaccatgtgtttgctatcactttatttgagaactttgtttattggtctgat
tgggaaacaaaaagcattcataaatgtcatatatattcaggccaagaatgtcgaaatgtt
acatcacttgcttacagaccaatggatattaaagttgtgcatcctcttttacaaccatca
agagcatacaacccctgtgaaaaaaataacggtggatgcaaaggtttgtgtcttttatca
ccaaatttgggtagaacatgtgcatgtcctcaagattttattcttgcaccagacaatatg
aattgtattgcaaattgttcttcatcccattttgtgtgtgcaaatacatttaaatgcata
cccttctggtggcattgcgataaacatgatgactgtggtgatggttctgatgagcctgac
acttgtttagactttctgtgtactcctggacagttccaatgtaaaaatcatcagtgtata
cagccttcacaaatatgtaatggcatatttgattgtaaagacaattctgatgaagaaaac
tgtggaaattatacatgtcttgatacggactttaaatgtcaacatggctctaaattcagc
aaattaccaatgccaacttgtatatcgaatcagctgaaatgcaatggtcgcaatgattgt
ttggatggcgaagatgaaaaagattgtaaatcgaaaacatgtggtgcaaaggagttcaaa
tgcgagattacagggaagtgtattccaaatgtgtttatgtgtgatggtgaatatgattgt
ggttttggtgataattctgatgaaccagaaaattgtacttcaagatcatgttcatcagat
gaagtgcgttgtaaaaatggtcgatgtatccattcaacatggatgtgtgatggtgaaaat
gattgtcctgatatggacgatgaaccaccttcatgttataacatcacgtgtgatccaaca
tactttaagtgtgctaatggaaagtgtattccaggtcgttggcgatgtgataatgaaaat
gactgtggtgataaatctgatgaaattggctgctcaccaagaaattgttcagaacatgaa
tttcgatgctctgatggtcgatgtatattaactagtcaaaaatgtgatggaaaaattaac
tgttcagataatagtgatgaggatgattgtgattcacatgttacttgtggaagtgatgac
tttcactgtaatgggtcctatcattgtatttcaccaacatggaggtgtgatggagatcaa
gactgtcctgatggttctgatgagtggaattgtacagataaacttggaaaaggatgttca
attagtcgtaatggccaatttgtatgtaaaaatggtgattgtatatcacttggaaataga
tgtgatggcgaagaagattgtgctgatggcagtgatgaaaaccgaactatgtgtgcatta
gtggcttgtccacctggaaaataccgatgtgacaatcataattgcgtttttaatacaaat
gtctgtgatggtttggatcattgtggtgatggctctgatgaaaataaagtggcatgtgcc
agtgctagtgaaatatgcgattcaagtaaatttagatgtgcaaatggtctatgtataaac
cgacatcttcgatgcaatgggttttttgactgtcccgataattcagatgaacagctatgt
aatgtgactaaaacatcatgtcaatttgggacatgttctcagatttgcgtacctaaaaaa
aactccactcattcttgccattgtgcctctggttatagcataactcttcctaataaatca
tgtcaggctattggtactccagcattattagttgtggctaacaatgaaggagatattttc
tttgttgatccatacaaatcccatgaaaacttatttaaatattctgctgttacaatacca
tctcataaaatacattcaattgatatattgtggacgataaatgcaacatatctgttttgg
agtgatcataactctaaagccttatattctacaattattgataaatcaaatcgaactacc
cgtgatgtaaatactgctaaaaaaattattcaaactataggcacccctgaaagtattgct
gtggattgggttgcaaacaatttgtattggattgaaacttctgacagaaccaaagttatt
aaagtagctactctggatggaaaaaatattagaactttggtaaaacttgaaacagatcgt
aaaccacaaaatatcgtattagatcctcagtctgggacaatgtattggacagatttgggt
cgtaaaccacgcattgaaacatgttcaatggatggttacaatagacgaacatttattagt
gagtctgttcgtagtcctgcaggtatcacaattgattatgctgctcgtcgtttgtattgg
tcagacaccaagccttatactatagaatctgttctattagatggaaaaggacgcaaagtt
atacataaatttcccaaaggtaaacatccaactaatattgagttatttgaggattcaatt
tatgtatcacttatgacaacgattgtaaaaattgacaagtttgaaaataagaatataact
accttatcgaaaaatatctttagggctacagatttagttattatgcaagagaataaacat
ccaaaagacttgaataacttttgtcttataaatccatgtcatcatactgcattgtgtact
ttgagtatgaatcccaaaaatagaacttgtatgtgtgcagatgaccaagtagaagttcct
acattgacggacgacattaaatgtgtagataagcaaactcctcctttaatttgtgatcca
tcatgcgatatgggagaatgtgtattaaacgtgacatcagaattgggttattgtaaatgt
aatccattttttggtggagagacatgtaatgagtacgaatgtcataaatattgtcacaat
aaagcctcctgttatgtattccatgaagacatactcgaagaatccaaactcaaggtactt
gtctatgttctatttattggaccggtgatagatgtgatattcctgtacctccaaaagtgt
tgtccaaaaggagggaattgcttgaatggtggaatttgtattgacaatatttgtgactgt
atgccaggctttacaggtgaattttgtgaaaaatgtgtgaacgttgattgtaaaaatgga
ggagtatgtgtcttaactgattctggccatggtgaatgtaagtgccctgctggatatatg
ggccccacatgcactaaatcagattgtgataactactgtattaagggaacttgcttttta
gattccaatggtcctatttgcaaatgccatgaaggatatactggaccacattgtgaattt
gataaatgtgacaacaataattgtttaaatggcggatcttgttatatcaaagacaatata
acggcttgtttatgtttaccacaattcaaaggtccgtcttgtcgtatagatatttgtaac
tgtacatgtgataaaaatgatcacgagtgtcacatatattgccctcctaatcggaaatat
cctttatgtgatcaaattaattctaccacaaatttgtgtcatccagaaatgtgcaaaaat
ggtggtacttgtatcattgttgatggactacccgcctgcaggtgtgttggcctttggggt
tcatctgactgcagtaatataattgtagattctggatcttgtttgggttattgctataat
aatggtacatgttacatggaatcaaattctggtgtaaatgaacctaattgtaagtgtagt
tcaggatggactggatcacggtgcgctgatcggttcacttgtgcaaattattgtataaat
ggtggcacatgtatagagcctgaagaatctattgggagcttatcatgccattgtcaaaaa
ggttatattggcgacagatgccaaacccaattaatagatgaatatatgtcttcagaacat
caaaataaacacagtataaatgctttgtgggtaatattcttaattattgtactgtcaatt
gtcattactgctactacatattatttcaccaagcttagaagaagaggtcgttcattttca
catgtaagaatgcaagaaaattcagaagtcaataatccaatgtacattcaagatgatata
gatgatgaagatgttcatctggatcgttcttttccattacaagaaaaacctagtggacat
tttggaaacccagtatacgactctgtgtacagtgctagtagtagtgcatcagttactggc
agtgaagaaagcaaaggtcttttacagagcactaatttgacaaatcaaatattgacacca
gaaaatagccacgatgaaacataa

DBGET integrated database retrieval system