KEGG   Acyrthosiphon pisum (pea aphid): 100163376
Entry
100163376         CDS       T01076                                 
Name
(RefSeq) esterase E4 isoform X1
  KO
K03927  carboxylesterase 2 [EC:3.1.1.1 3.1.1.84 3.1.1.56]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100163376
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100163376
    3.1.1.56  methylumbelliferyl-acetate deacetylase
     100163376
    3.1.1.84  cocaine esterase
     100163376
SSDB
Motif
Pfam: COesterase BD-FAE Abhydrolase_3 Peptidase_S9
Other DBs
NCBI-GeneID: 100163376
NCBI-ProteinID: XP_001950655
APHIDBASE: ACYPI004468
UniProt: J9JVS2
Position
A1:complement(129266965..129275738)
AA seq 556 aa
MVSGTLKSTYNFRTRIKMIIKWTFIAVVLYLDLVQCIPQELKITKGVIKGQILKSRNGRS
YYSYTGIPYAKPPIGELRFKAPVPVGPWDGILDATKESNICIQQGSTDGQEDCLYLNVYS
PKTNEKSLPVMFWIHGGGFTWGHSRSGLYGPDYLMDKDVILVTMNYRLGIFGFLSAEDDV
IPGNYGVKDQVAALRWVQENIMHFNGDPNRVTISGGSSGGASTGYHMLSPMSKGLFHKAI
LQSGAPVCKWAVLPPGIPRKRAHAVATISGCNFDTSEDILKCLRQIPAQYLIDLHTKLFT
WIVHPFILFNPVVENCNTGQEAFLCHHPIYDFHQESFVPAIVGLNSAEGGLFVAAMYNNT
ALLHPELRTDFNRLISIMMNYNYYTTPENIDEIGEKVLKKYFPSGGIDDHTHINAVKMFT
DSCFTECVIDMAYKLSSPVYSYFYNYQNEFSYNKAFGSCERPLGVTHGDELNSIFKMNSL
NPNDLNEKDLEVSKLVINIWYKFVASDNPTIDGLENGLPWPEFTKPNQSVILFNSSHPSL
IQNPCMDAYAFWKKLI
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggtatctggtacactgaaatctacatataatttcagaacacgcataaagatgattata
aaatggacttttattgctgtcgtgctgtacttagatttggtgcaatgcataccacaggag
ttgaaaataactaaaggcgtgattaaaggacaaattttgaaatctcgaaatgggcggtct
tattattcttataccggaataccatacgcaaaaccaccaattggagaacttaggtttaag
gcaccagtaccggtgggaccatgggacggcatattggacgctacgaaagaatcaaatatc
tgtattcaacagggaagcacggacggtcaggaagactgtttgtatttaaatgtatattct
ccaaaaacgaatgaaaagtcgttaccagtcatgttttggattcacggaggaggatttact
tggggccacagtaggtctggtctatacggaccagattatcttatggacaaggacgtgata
ttggtaacaatgaactatagacttggtatattcggatttctcagcgccgaagatgatgtg
atacccggaaactacggagtaaaagatcaagtagccgcattacgttgggtgcaggaaaac
ataatgcattttaacggtgatcctaatcgagtgacaatttccggcggaagttcaggaggt
gctagcacaggatatcatatgctatcgccgatgagtaaaggtctttttcataaagccata
cttcaaagtggtgcaccggtttgcaagtgggccgttttacctcctggaattcctcgtaaa
cgcgcccatgcagtggcaactatttcagggtgtaatttcgatacatccgaagacatattg
aaatgtttgagacaaatcccagctcaatatttgatagatcttcacaccaaattattcact
tggattgttcatcctttcattttattcaatcctgtggttgaaaactgtaatactggtcaa
gaagcatttctttgtcatcatccaatatatgactttcatcaagagtcgttcgtaccagct
attgttggtttaaattcagccgaaggtggtttgtttgttgctgctatgtacaacaatacg
gcattactacatccagaacttcgtacggattttaatcgtttaatatcaataatgatgaat
tataattattatacaacacctgagaacattgacgaaattggagaaaaagtgcttaaaaaa
tatttcccatctggaggtatagatgatcatacgcatatcaacgctgttaaaatgttcacc
gattcatgttttacagaatgtgttattgatatggcatataaattgtcatctcccgtgtat
agttatttttataattatcaaaatgaattttcttataataaagcatttggctcatgtgag
agacccttaggagtcacccatggcgatgaactaaatagtattttcaaaatgaatagctta
aatccaaatgatttaaacgaaaaagatcttgaagtttcgaaattagtcattaatatttgg
tataaattcgttgcatctgataatcctaccatcgatggattagaaaatggtttaccttgg
cctgaatttacaaaaccaaaccaatcggtgatcctattcaattcaagtcatcccagtctt
attcaaaatccatgtatggatgcttatgcattttggaaaaaacttatataa

DBGET integrated database retrieval system