KEGG   Acyrthosiphon pisum (pea aphid): 100163959
Entry
100163959         CDS       T01076                                 
Name
(RefSeq) pancreatic triacylglycerol lipase
  KO
K14073  pancreatic triacylglycerol lipase [EC:3.1.1.3]
Organism
api  Acyrthosiphon pisum (pea aphid)
Pathway
api00561  Glycerolipid metabolism
api01100  Metabolic pathways
Module
api_M00098  Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:api00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    100163959
Enzymes [BR:api01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.3  triacylglycerol lipase
     100163959
SSDB
Motif
Pfam: Lipase Abhydrolase_1 Abhydrolase_6 PLAT LIDHydrolase
Other DBs
NCBI-GeneID: 100163959
NCBI-ProteinID: XP_016662538
APHIDBASE: ACYPI005007
UniProt: A0A8R2H6D1
Position
A2:complement(11793326..11825798)
AA seq 533 aa
MVRGHVALCIATLATFVRSGAAGILEWGRSNHIEVNIPWLPFENETRCYDELGCLNITRD
WYHLIYRPFNVFPLARQVIDTRFILYTRKNPLQGQMLKVQSEKTIQKSNFDPKKPTKFII
HGFIDTPLSNWVKEMRRELLKHSDWNVIVVDWAGGSLPLYTQATANTRLVGLEIAYFINY
LKDNVGLNPKHVHLIGHSLGAHTAGYAGERIEGLGRITGLDPAEPYFQGMPSHSRLDPSD
AQLVDVIHTDGSSIFLLGYGMSEPCGHIDFYPNNGKEQPGCDLTETPLPLTLIKEGIEEA
SRVLVACNHVRAIKLFIESINSKCPYVAHKCNSYQNFLQGKCFSCKENDTGCAIMGLNTV
RPNHAPGSKYFISTGKDTPYCRRQYKVMLDLAKPPRAESWVQGFMKVSLHSDNGVIRNLD
LTPNGYERMEHGTSRSFVVTHPDDIGQVKRVEFYWEYDMDVLQPRSICFFWCNDHLYVSS
IGVTEAEDDGNRGKRGIQVDTKLCSQGPREYADIASRTSAVFIDKCEDQELLN
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggtccgaggtcatgtggctttgtgcatagcgacgctcgcgacgtttgtgcggtcaggc
gcagcgggcattctcgaatggggacgatccaaccacatagaggtcaacataccctggtta
ccatttgaaaacgaaacaagatgttacgacgaactagggtgtttaaatatcacccgagat
tggtatcatcttatatatcggccgttcaatgtgtttccattagcgaggcaagtcatcgac
acacggtttatattgtacacgagaaaaaatccattacagggtcaaatgctgaaagtacaa
tcggagaaaacaatacaaaagtccaattttgatcccaaaaaacctacaaaattcattata
cacggttttatagacacgcctttgagcaattgggtcaaggaaatgaggagagaacttctg
aaacattctgattggaatgtaattgtagtggactgggccggcgggtcgttgcctttatac
acgcaggcaacagccaatacgcggcttgtgggactagaaatcgcctatttcatcaactat
ttaaaagataacgtgggcttaaatccgaaacatgttcatctgataggacacagtctgggc
gctcacactgccgggtacgccggtgaacggatcgaagggctaggacgaatcaccggactt
gatcctgctgaaccatatttccaaggaatgccttcacactccagactggatccttccgat
gcgcaacttgtggatgtcatacacaccgacgggtcttccatatttctgttggggtacggg
atgagcgaaccttgtggccacattgacttttatccaaacaacggtaaggaacagcctggc
tgtgatctaacggaaactccattacctctcactctcatcaaagagggaattgaagaagca
agtcgtgttttagttgcttgtaatcacgtaagagccataaaactgttcatcgagtctata
aactcaaaatgtccatacgtcgcacacaaatgcaactcgtatcaaaacttcttacagggt
aaatgcttctcgtgcaaggagaatgatacaggttgtgccataatgggcttaaatacagta
agaccaaaccatgcaccgggctccaagtatttcatatctactgggaaagatacgccatac
tgtagacgacaatacaaggtcatgttggatttggccaagccacctagggctgagtcttgg
gttcaaggttttatgaaagtgtcgctacatagtgacaacggtgttatcagaaacctagat
ttaactcccaatggttatgagcgtatggagcacgggaccagtcggagctttgtggtcacc
catccggacgacataggacaagtgaaacgagtagagttttactgggagtatgacatggac
gtgctacaacccaggtccatatgtttcttctggtgcaacgaccatctgtacgtgtctagt
atcggtgtaacagaagccgaagacgacggaaatagaggtaaacgaggtatccaagtggat
actaagttgtgcagccagggtccgagagagtatgctgatattgcctcaaggacttcagcc
gtgttcatcgacaaatgtgaagaccaagagcttctaaactaa

DBGET integrated database retrieval system