KEGG   Acanthaster planci (crown-of-thorns starfish): 110990350
Entry
110990350         CDS       T05078                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 24-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
aplc  Acanthaster planci (crown-of-thorns starfish)
Brite
KEGG Orthology (KO) [BR:aplc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aplc03036]
    110990350
Chromosome and associated proteins [BR:aplc03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    110990350
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Other DBs
NCBI-GeneID: 110990350
NCBI-ProteinID: XP_022111002
Position
Unknown
AA seq 489 aa
MSETASSVATNSVAESKLGVASKTVTTAAHQLSKPGSREPTSRPTFDNDEFMAAAIGDTA
WLKQSLRSGRDPSQYDRNGLAAIHLAALHGRLECLKLLVEKYKVDVNLPSSTGWRPVHLA
INSRTGKRSLSCVQYLLDQGADASLVNEDDLTPAHQAAIEGSVKCLEALINSNAAIHLQD
NKGHLPLDYAKIWGHRKCARILASESWRQGKNYQAGEMEKLKHLRTLKEDDDRDAEESQL
AHKEFYGSLSFTNWLDEKGLQPKPIGPPLKRVSRPDIILKMGDSRTTKNMMYKANSMTQG
KQRSPPRDQPRTSKPQQKGRVSDVLAKHKPNKKNVAQQRDGKHSPHVAFVNVPDGKTRPC
METAVIPDLPQDVVERVIEQKPSPHDRPLEFKCKNIIDAQHRRLFTGDVKTESEMYAHIS
DSLDSRLFPGNSRLLLETHASSRSGHSEESSGSGNIDVERVAKMMKELSKPPRFPPIEGH
SYKYSFEVM
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgtcggaaacagcctcttcagttgccacaaactctgtggcagaatccaagctgggcgtt
gcatctaagactgttacaacagctgctcatcagttgagtaaaccaggcagcagggagcct
acaagccggccaacctttgacaatgatgaatttatggcagctgccattggagacacagca
tggctgaagcagtcattgagatcagggagagatccatctcagtatgatagaaacggtcta
gcagccattcatctcgctgcactccacggcagactggaatgtttgaaactcctggtggag
aaatacaaggtggatgttaaccttcccagcagcacgggctggagaccagtccaccttgct
atcaacagcagaactggcaaacgttctctcagctgtgtgcagtatttgctggaccaaggg
gctgatgcctcacttgtaaatgaggatgacttaacacctgctcaccaagcagctatagag
ggtagtgtcaagtgcctagaggcactgatcaactccaacgctgccattcacttgcaagat
aacaagggccatctaccacttgactatgctaagatctggggtcacaggaaatgtgcccgg
attctagcatctgaaagctggaggcaaggtaaaaattatcaggctggtgagatggagaaa
ctgaaacaccttcgcaccttgaaagaggatgatgacagggacgcagaggaatcccagctg
gcacataaggaattctacggcagtttgtccttcacgaattggcttgatgagaaggggctt
caaccgaagccgattgggcctcctctgaaacgagtatctcgacctgacataatactgaaa
atgggagattctagaaccactaaaaatatgatgtataaagcaaacagcatgactcaaggc
aagcaaagaagtccaccaagggatcaaccacgtactagcaagcctcagcagaagggaaga
gtttcagacgtgttggcaaagcataaaccaaacaaaaagaatgtggcacagcaacgggat
ggaaagcatagtcctcatgtggcatttgtcaacgtacctgatggcaaaacaaggccgtgc
atggaaacggctgtgatacctgacctgccacaggacgttgtagaaagggtgattgagcag
aagccttcgccccatgaccggccgctggagttcaagtgcaagaatatcattgacgcccag
caccggcggctgttcactggtgatgtcaagaccgagtcagagatgtacgcacacatctca
gacagcctggactctcgactgtttcctggtaattctagactcttgctggagacgcatgcc
agctctcggtccggtcacagcgaggagtctagtggctcaggcaacattgatgtagaaagg
gttgctaagatgatgaaggaattatctaagccaccacgatttcctccgattgaaggacac
agttacaagtactcttttgaagtcatgtga

DBGET integrated database retrieval system