KEGG   Arcobacter sp. L: ABLL_0216Help
Entry
ABLL_0216         CDS       T01834                                 

Definition
(GenBank) GTP cyclohydrolase II
  KO
K01497  GTP cyclohydrolase II [EC:3.5.4.25]
Organism
arc  Arcobacter sp. L
Pathway
arc00740  Riboflavin metabolism
arc00790  Folate biosynthesis
arc01100  Metabolic pathways
arc01110  Biosynthesis of secondary metabolites
arc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:arc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    ABLL_0216
   00790 Folate biosynthesis
    ABLL_0216
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ABLL_0216
Enzymes [BR:arc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     ABLL_0216
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: BAK72091
UniProt: G2HRX5
Position
200482..201057
Genome map
AA seq 191 aa AA seqDB search
MNTIQSNIANLPTRYGKFKIKAYKQGTQEHLAIMSQDFETLESPYVRIHSECLTGDTLGS
LKCDCQNQLDLSLKFIAQNGGLVIYHRQEGRNIGLVNKVNAYALQDQGRNTIEANLELGF
KEDERDYSIVGHIFRDLDIKKLKLITNNPEKMQYVDSLGVEIIERIPAITKSNKYNEGYL
STKKNKMGHLL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaatacaatacaatcaaatatagcaaatttacctacaagatatggaaaattcaaaata
aaagcttataaacaaggaactcaagaacatttagcaattatgagtcaagattttgagaca
cttgaatcaccttatgtaaggattcactcagaatgtttaaccggagatactttaggaagt
ttaaagtgtgattgccaaaatcaacttgatttatcactaaaatttatagctcaaaatggt
ggattagtgatttatcacagacaagaaggaagaaatataggtttggttaataaagtaaat
gcttatgcgcttcaagaccaaggaagaaatacaatagaagcaaatttagaattaggcttc
aaagaagatgaaagagattactctattgtaggacatatctttagagatttagatataaaa
aaattaaagttaattacaaataatcctgaaaaaatgcagtatgtcgatagtttaggtgta
gaaataatagaaagaattcctgcaattactaaatcaaacaaatataatgaaggttattta
tctaccaaaaaaaataaaatgggacatttactataa

DBGET integrated database retrieval system