KEGG   Arabidopsis thaliana (thale cress): AT1G50250
Entry
AT1G50250         CDS       T00041                                 
Symbol
FTSH1
Name
(RefSeq) FTSH protease 1
  KO
K03798  cell division protease FtsH [EC:3.4.24.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT1G50250 (FTSH1)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:ath03110]
    AT1G50250 (FTSH1)
Peptidases and inhibitors [BR:ath01002]
 Metallo peptidases
  Family M41: FtsH endopeptidase family
   AT1G50250 (FTSH1)
Chaperones and folding catalysts [BR:ath03110]
 Other chaperones and cochaperones
  AAA proteases
   AT1G50250 (FTSH1)
SSDB
Motif
Pfam: Peptidase_M41 AAA AAA_lid_3 FtsH_ext AAA_5 AAA_16 TIP49 nSTAND3 AAA_22 AAA_2 AAA_28 RuvB_N AAA_14 IstB_IS21 AAA_33 Mg_chelatase AAA_17 LonB_AAA-LID bpMoxR AAA_7
Other DBs
NCBI-GeneID: 841447
NCBI-ProteinID: NP_564563
TAIR: AT1G50250
UniProt: Q39102 A0A178W3Y5
Position
1:complement(18614201..18617155)
AA seq 716 aa
MASNSLLRSSSNFFLGSHIIISSPTPKTTRKPSFPFSFVSRAKYQITRSSQDENSPNGKP
NSPFSSQVALAAILLSSISSSPLALAVVDEPASPSVVIESQAVKPSTPSPLFIQNEILKA
PSPKSSDLPEGSQWRYSEFLNAVKKGKVERVRFSKDGSVVQLTAVDNRRASVIVPNDPDL
IDILAMNGVDISVSEGESSGNDLFTVIGNLIFPLLAFGGLFLLFRRAQGGPGGGPGGLGG
PMDFGRSKSKFQEVPETGVSFADVAGADQAKLELQEVVDFLKNPDKYTALGAKIPKGCLL
VGPPGTGKTLLARAVAGEAGVPFFSCAASEFVELFVGVGASRVRDLFEKAKSKAPCIVFI
DEIDAVGRQRGAGMGGGNDEREQTINQLLTEMDGFSGNSGVIVLAATNRPDVLDSALLRP
GRFDRQVTVDRPDVAGRVKILQVHSRGKALGKDVDFDKVARRTPGFTGADLQNLMNEAAI
LAARRELKEISKDEISDALERIIAGPEKKNAVVSEEKKRLVAYHEAGHALVGALMPEYDP
VAKISIIPRGQAGGLTFFAPSEERLESGLYSRSYLENQMAVALGGRVAEEVIFGDENVTT
GASNDFMQVSRVARQMIERFGFSKKIGQVAVGGPGGNPFMGQQMSSQKDYSMATADIVDA
EVRELVEKAYKRATEIITTHIDILHKLAQLLIEKETVDGEEFMSLFIDGQAELYIS
NT seq 2151 nt   +upstreamnt  +downstreamnt
atggcttctaactcattactacgttcttcttcaaatttcttcttaggatcccatatcata
atctcatctcccacccctaaaaccaccagaaaaccctctttccctttctccttcgtctcc
cgtgctaaataccaaatcactcgatcgtctcaagacgaaaattcgccaaatggtaaaccc
aattcgccattctcgtcgcaagtagccttagcagctattctactatcttcaatttcatct
tcgccgctagctttagctgtagtggacgaaccagcttctccgtctgtcgttatagaatct
caagctgtgaagccatcgacgccatcgccattgttcattcagaacgagatacttaaggct
cctagtcctaaatcatcggatctcccagaaggatcacagtggcgatacagcgagtttctt
aacgctgtgaagaaagggaaagtcgagagagttagattcagcaaagatggttctgttgtt
cagcttactgccgtcgacaatcgccgtgcttcagtcatcgtccctaacgaccctgacctt
attgatatcttggctatgaacggagttgatatatccgtctctgaaggagaatcctcaggc
aatgacttgttcactgtcattggaaacttgattttcccgcttttggcctttggtggactc
ttcttgcttttcaggcgagctcagggaggccctggtggtggtcctggtggcttgggtggt
cctatggatttcggacgttctaaatccaagttccaggaagtgcctgagactggtgtatca
tttgcagatgttgctggggctgatcaagctaagttggagttacaggaagttgtggatttc
ttgaagaatcctgataagtacacagccttgggtgctaagattcctaaagggtgtttgctt
gttggaccgcctggtacgggtaagacactcctggctagggcggtggctggggaagctgga
gtgccgttcttctcttgcgcggcctcggagttcgtagagctttttgtgggtgtgggtgca
tcgagagttagggatttgttcgagaaggctaagtctaaagccccttgtattgtattcatt
gatgagattgacgctgtgggtaggcagagaggagctgggatgggaggaggaaatgatgag
agagaacagactattaatcagctgttgacagagatggatggattttctggcaactctggt
gtgatagttttggcagctacgaataggccggacgttcttgattcggctttgttgaggcct
ggaaggtttgatcgacaggtcacggtggataggcctgatgtggctggcagagtcaagatt
cttcaggttcattctagggggaaggcactcggtaaagatgtggactttgacaaggttgcc
agaaggacccctggtttcacgggtgctgacttacaaaacctgatgaatgaagcggcgatt
cttgcggctaggcgtgagcttaaggaaataagcaaggatgaaatctctgatgctcttgag
aggatcattgctggacctgagaagaagaatgcagttgtctctgaagagaagaagagactt
gttgcataccatgaggctggtcatgctctagtgggtgctcttatgccagaatatgatccg
gttgcaaagatttctatcattcctcgtggccaagctggtgggctcactttttttgctcca
agcgaagaaagacttgagtctggattgtacagtaggagctaccttgagaatcaaatggct
gttgcacttggcggaagggttgcagaggaggtgatctttggggatgagaatgtgacgact
ggagcatcaaatgatttcatgcaggtgtctcgtgtggcacgtcaaatgattgagagattt
gggttcagcaaaaagattggacaagttgctgttggtggccctggtggaaatcccttcatg
ggtcaacaaatgtcatcacagaaagattactcaatggcaactgcggatattgtagatgct
gaggtgcgagagttagttgagaaggcatacaagagagcaacggagatcataacaactcat
attgatatcctacacaagcttgcacagctcctgatcgagaaagaaactgttgacggtgaa
gagttcatgagtctctttattgacggccaagctgagttgtatatttcttga

DBGET integrated database retrieval system