KEGG   Arabidopsis thaliana (thale cress): AT1G80600
Entry
AT1G80600         CDS       T00041                                 
Symbol
WIN1
Name
(RefSeq) HOPW1-1-interacting 1
  KO
K00818  acetylornithine aminotransferase [EC:2.6.1.11]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AT1G80600 (WIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT1G80600 (WIN1)
Enzymes [BR:ath01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     AT1G80600 (WIN1)
Amino acid related enzymes [BR:ath01007]
 Aminotransferase (transaminase)
  Class III
   AT1G80600 (WIN1)
SSDB
Motif
Pfam: Aminotran_3 DUF5839 SBP_bac_3
Other DBs
NCBI-GeneID: 844399
NCBI-ProteinID: NP_178175
TAIR: AT1G80600
UniProt: Q9M8M7
Position
1:complement(30298462..30300658)
AA seq 457 aa
MASLSQITLPRAPSSEIGLLRRRLERPIIRTRIGFNGRIASVLTNAGDQAVSVKASVSQK
VIEEEAKVIVGTYARAPVVLSSGKGCKLFDPEGKEYLDCASGIAVNALGHGDPDWLRAVT
EQAGVLAHVSNVYYTIPQIELAKRLVASSFADRVFFCNSGTEANEAAIKFSRKFQRFTHP
EDKEVATGFIAFTNSFHGRTLGALALTSKEQYRTPFEPIMPGVTFLEYGNIQAATDLIRS
GKIAAVFVEPIQGEGGIYSATKEFLQSLRSACDAAGSLLVFDEVQCGLGRTGLMWAYEAF
GVTPDIMTVAKPLAGGLPIGAVLVTEKVAETINYGDHGSTFAGSPLVCSAAIAVMDKVSK
PSFLSSVSNKGRYFRDLLVKKLGGNSHVKEVRGEGLIIGVELDVPASSLVDACRDSGLLI
LTAGKGNVVRIVPPLVISEEEIERAVEIMSQNLTALD
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcgtctcttagccaaatcaccctgccacgcgcgccgtcgtcggagattggcctctta
cgccgtcgattggagcggccgatcatcagaacccggatcggattcaacggccggattgcg
agcgtattgactaacgcaggggaccaagcggtgtcggtaaaagcgagtgtgagccagaag
gtgattgaagaggaagccaaagttattgtgggtacctacgcgcgagctccagtggttctc
tcgagtgggaaaggttgtaaattgttcgaccctgaaggaaaagagtatctggattgtgca
tctggaatcgctgtgaatgctcttggtcatggagatcctgattggcttcgagctgtcact
gagcaagctggtgttcttgcccatgtcagcaatgtttattacacgatccctcagatagag
ctcgcaaaacgcttggtggcgagttcttttgcagaccgtgtattcttttgtaactcggga
acggaagccaatgaagcagccattaagttttcaagaaaattccagagattcacccatcca
gaagacaaagaagtcgcgacaggtttcatcgcctttacaaacagcttccatggaagaacc
ttaggagctcttgccttgacaagcaaagaacaatacagaactcctttcgaacccatcatg
cctggtgtaaccttcttagaatatggtaacattcaagcagccacagaccttatccgctca
ggtaaaatagctgcagtttttgtggaaccaattcaaggagaaggcgggatttactctgct
acaaaagagtttctgcaatctctgcgctctgcttgtgatgccgctggatctcttctcgtc
ttcgatgaggttcaatgtggtttgggtcgaacgggtctcatgtgggcttatgaagccttc
ggtgtgactcctgacataatgacggttgcaaagcctttagctggtggtttacctattgga
gcggtgctggtgactgaaaaggttgcagagaccataaactacggagatcatggaagtaca
tttgcaggcagccctcttgtgtgcagtgcagccattgcagttatggataaagtatcgaaa
ccctctttcttgtccagtgtctcaaataaaggtcgatactttagagacctgttggtgaaa
aaacttggaggaaactcgcacgtgaaggaagtgagaggcgaagggcttatcataggagtg
gagctcgatgtgccggcaagctcactggttgatgcttgccgagattcgggtcttctgatc
ttgacagcggggaaaggaaatgtcgtcaggattgttcctccgttggttatatcagaggag
gaaatcgaacgtgcggttgagatcatgtctcaaaatttgactgcgcttgattga

DBGET integrated database retrieval system