KEGG   Arabidopsis thaliana (thale cress): AT2G01735
Entry
AT2G01735         CDS       T00041                                 
Symbol
RIE1
Name
(RefSeq) RING-finger protein for embryogenesi
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: zf-RING_2 zf-RING_11 zf-rbx1 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-C3HC4_3 zf-RING_5 zf-ANAPC11 PBP1_TM DUF4728
Other DBs
NCBI-GeneID: 814703
NCBI-ProteinID: NP_849924
TAIR: AT2G01735
UniProt: Q8GUU2
Position
2:324365..326094
AA seq 359 aa
MSSYSSDSTAARDQHAPLLRPRHDGSFSSSSSSARPTALAVLLGRITGHRAPSMLVRETA
ARALEERRIDWGYSKPVVAADILWNAALVLASAVMLVGTVEERPNEPIRVWICVYGLQCL
FHVVLVWSEYWRRNSTRRARDLESYDHEDYNIEYDYEQDSDDNSTTYSFVKRCESINTVI
SFIWWIIGFYWVVEGGDKLLGEAPNLYWLSVIFLAIDVFFAVFCVVLACLVGIALCCCLP
CIIALLYAVAGTEGVSEAELGVLPLYKFKAFHSNEKNITGPGKMVPIPINGLCLATERTL
LAEDADCCICLSSYEDGAELHALPCNHHFHSTCIVKWLKMRATCPLCKYNILKGTTDQS
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgtcatcgtattcttcagattccacggcggcgcgtgatcaacatgcgcctctactccgt
ccacgacacgacggctctttttcttcttcttcttcatcagccagacctacagctctcgcc
gttctattaggacggatcaccggccaccgagcaccgtcgatgctggttagagaaacagcg
gcgcgtgctctcgaggagagacgaatcgattggggttactcgaagcctgtagttgctgct
gatatactatggaacgctgctttagttcttgcgtcagcggttatgcttgtcggtaccgtt
gaagaaagacctaatgaaccgattagggtttggatctgtgtgtatgggttacagtgtttg
ttccatgtggttttggtttggtctgagtattggagaagaaactcaactcgtagagctagg
gatttggagtcttatgatcatgaagattacaacattgagtatgattatgaacaagacagt
gatgacaattcaacaacttacagttttgtgaagagatgtgagtcgataaacacagtgata
tcattcatatggtggataattggattctactgggttgttgaaggtggtgataagctttta
ggagaagctcctaatctttactggttatcggtgattttcctggcgattgacgtcttcttt
gctgttttctgtgttgttttggcttgccttgttggaatagctctttgttgctgtcttcct
tgcataattgctcttctttatgccgttgctggaacggaaggtgtatcggaggcggagctc
ggtgttcttcccttgtacaaatttaaggctttccatagcaatgagaagaacattactgga
cctggtaaaatggttcctataccgatcaatggcttatgcttagcaactgaaagaacactg
cttgctgaggatgcggattgttgcatatgtctgagttcatatgaggatggcgcagagctt
catgctcttccttgtaaccaccattttcattcgacttgtattgtgaaatggcttaagatg
agagcaacatgccctctttgcaaatacaacattcttaaaggaaccactgatcaatcttga

DBGET integrated database retrieval system