KEGG   Arabidopsis thaliana (thale cress): AT2G02710
Entry
AT2G02710         CDS       T00041                                 

Gene name
PLPB
Definition
(RefSeq) PAS/LOV protein B
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PAS_9 PAS PAS_3 PAS_4 PAS_8
Other DBs
NCBI-GeneID: 814800
NCBI-ProteinID: NP_565288
MIPS: AT2G02710.1
TAIR: AT2G02710
UniProt: O64511 A0A178VU83
Position
2
AA seq 399 aa
MSLTKSSESVFTEEEEEDSFSGRYTLWIKEALEELPHNFTITDPFISGHPIVFASLGFLK
MTGYSREEVIGRNGKVFQGPKTNRRSIMEIREAIREERSVQVSLLNYRKSGSPFWMLFHM
CPVFGKDDGKVTNFVAVQVPISGREHHRKKLRNVGDLSSDTSPTFGSCRREVCFGNFVCQ
DRALPVECDDDEQGLEDWEQCEASESEKLKATEAINNVLSILVHYSELSGRLVCGKRYCL
RGVDCLSSSLVISLGRIKQSFVLTNPCLPDMPIIYASDAFLTLTGYKRQEVLGQNCRFLS
GVDTDSSVLYEMKECILKGQSCTVQILNYSNRKDKSSFWNLLHISPVRNASGKTAYFVGV
QVEASCRNTEIKELRPETRQLSVVGAVRVAVRSSLMVTC
NT seq 1200 nt   +upstreamnt  +downstreamnt
atgtccttaacgaaatcttcagaatcagttttcactgaagaagaagaagaagattccttt
agcggtcgatacacgttatggatcaaagaagcattagaggagcttccacacaatttcaca
atcaccgacccgtttatttcgggtcacccgattgttttcgcgagcttagggtttttgaaa
atgactggctattcacgagaagaagtgatcggaagaaacggtaaagtttttcaaggacct
aagactaatcgaagatcgatcatggagattcgtgaagcgattcgtgaagagagatcagtg
caagtgagcttgttgaattatcgtaaatctgggtctccgttttggatgttgtttcatatg
tgtcctgtttttgggaaagatgatggtaaagtcaccaattttgtggcggttcaggtcccg
atttcgggacgagaacatcatcggaagaagttgagaaatgtcggagatttgtcgtcggat
acttctccgacatttggttcttgtcgaagagaggtttgttttggtaatttcgtgtgtcag
gatcgagctttaccagtggaatgtgatgatgatgaacaaggattagaggattgggaacag
tgtgaagcgagtgagtccgagaagctgaaagctacggaagctattaacaatgtgttatct
atcttagtgcattacagcgagttgagtggtagattagtctgcggaaagcggtactgcttg
cgaggagtagattgtctaagctcgtcgttagttatttctctcggtagaatcaaacaaagt
ttcgtattaaccaatccatgcttaccagacatgcctatcatttatgcgagtgatgccttt
ttgacactgaccggttacaagagacaggaagtgttgggacaaaactgtagatttctgagt
ggggttgatactgattcctcagtactatacgagatgaaggaatgcatcttaaagggacaa
tcatgcacagtgcaaatactaaattacagtaacagaaaagataagagctcattttggaat
cttcttcacatctcaccagttcgtaatgcttcaggcaagacagcatattttgtgggtgtt
caagtagaagcaagttgtagaaatactgaaattaaagagctgagaccagagacgagacaa
ctgagtgttgtcggtgcggttagagttgcggttagaagctcattgatggtgacatgctaa

DBGET integrated database retrieval system