KEGG   Arabidopsis thaliana (thale cress): AT2G31450Help
Entry
AT2G31450         CDS       T00041                                 

Gene name
ATNTH1
Definition
(RefSeq) DNA glycosylase superfamily protein
  KO
K10773  endonuclease III [EC:4.2.99.18]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AT2G31450 (ATNTH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G31450 (ATNTH1)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     AT2G31450 (ATNTH1)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     AT2G31450 (ATNTH1)
 Prokaryotic type
     AT2G31450 (ATNTH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HhH-GPD HHH HHH_5 EndIII_4Fe-2S
Motif
Other DBs
NCBI-GeneID: 817703
NCBI-ProteinID: NP_565725
MIPS: AT2G31450.1
TAIR: AT2G31450
Araport: AT2G31450
UniProt: Q9SIC4
Position
2
AA seq 379 aa AA seqDB search
MILLVNGGAATSIHPNAARFYRIGTMSRQIHGAVSSSKHISLKTQHPLSDSNSELAYGAS
GSETRVYTRKKRLKQEPFEPLEKYSGKGVNTHKLCGLPDIEDFAYKKTIGSPSSSRSTET
SITVTSVKTAGYPPENWVEVLEGIRQMRSSEDAPVDSMGCDKAGSFLPPTERRFAVLLGA
LLSSQTKDQVNNAAIHRLHQNGLLTPEAVDKADESTIKELIYPVGFYTRKATYMKKIARI
CLVKYDGDIPSSLDDLLSLPGIGPKMAHLILHIAWNDVQGICVDTHVHRICNRLGWVSRP
GTKQKTTSPEETRVALQQWLPKEEWVAINPLLVGFGQMICTPIRPRCEACSVSKLCPAAF
KETSSPSSKLKKSNRSKEP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgattcttctggttaacggaggagccgctacttcaatccatcccaacgccgctcgattt
tatcgaattgggaccatgagtcgccaaattcacggagctgtatcttcttctaagcacatc
tccttaaaaacccaacaccccctctcagattccaactcagaactagcctatggagcttct
gggtcggagactcgagtgtatacccggaaaaaaaggctaaagcaggaaccttttgagcct
ctggagaaatattccggcaaaggagtcaatacccacaaactgtgtggtttacccgatata
gaagattttgcttacaaaaagactattggatctccttcatctagcaggtcaacggaaact
agcatcactgtgacttcagtcaaaacagcaggatatccgcctgaaaactgggtcgaagtg
ctcgagggtattcgtcaaatgagatcttctgaagatgcaccagttgattctatgggatgt
gataaagccggaagctttctacctcccacggaaagaagatttgctgtcttgctaggagca
cttctttcaagtcagacaaaagatcaagttaataacgcggcaatacatcgtcttcatcaa
aacggccttcttactcccgaagcggttgacaaagctgatgaatcaaccataaaagaattg
atctatccggttggattttatacaaggaaggctacctatatgaagaaaatagctagaatt
tgtctagtgaaatatgacggagacattccaagctctttggacgacctgctgtctcttcca
gggattggtcccaagatggcccatctgattctgcatatagcatggaatgatgtccaaggc
atatgtgtagacacacatgtgcatcgcatttgcaatcgacttggttgggtgtctcgtcca
ggaaccaaacagaaaactacatctccagaggaaacaagagtagctttgcaacaatggctt
ccaaaggaagaatgggttgccattaacccgcttttggtggggtttggacaaatgatttgc
acaccaataagaccacgctgcgaagcctgcagtgtcagtaagctttgtcctgctgcattc
aaagaaacatcaagcccatcttccaagttgaagaaatctaaccgaagcaaagaaccatga

DBGET integrated database retrieval system