KEGG   Arabidopsis thaliana (thale cress): AT3G01500Help
Entry
AT3G01500         CDS       T00041                                 

Gene name
CA1
Definition
(RefSeq) carbonic anhydrase 1
  KO
K01673  carbonic anhydrase [EC:4.2.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AT3G01500 (CA1)
Enzymes [BR:ath01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     AT3G01500 (CA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_CA
Motif
Other DBs
NCBI-GeneID: 821134
NCBI-ProteinID: NP_186799
MIPS: AT3G01500.1
TAIR: AT3G01500
Araport: AT3G01500
UniProt: P27140 A0A178VK19
Position
3
AA seq 347 aa AA seqDB search
MSTAPLSGFFLTSLSPSQSSLQKLSLRTSSTVACLPPASSSSSSSSSSSSRSVPTLIRNE
PVFAAPAPIIAPYWSEEMGTEAYDEAIEALKKLLIEKEELKTVAAAKVEQITAALQTGTS
SDKKAFDPVETIKQGFIKFKKEKYETNPALYGELAKGQSPKYMVFACSDSRVCPSHVLDF
QPGDAFVVRNIANMVPPFDKVKYGGVGAAIEYAVLHLKVENIVVIGHSACGGIKGLMSFP
LDGNNSTDFIEDWVKICLPAKSKVISELGDSAFEDQCGRCEREAVNVSLANLLTYPFVRE
GLVKGTLALKGGYYDFVKGAFELWGLEFGLSETSSVKDVATILHWKL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgctcctctctccggcttctttctcacttcactttctccttctcaatcttct
ctccagaaactctctcttcgtacttcttccaccgtcgcttgcctcccacccgcctcttct
tcttcctcatcttcctcctcctcgtcttcccgttccgttccaacgcttatccgtaacgag
ccagtttttgccgctcctgctcctatcattgccccttattggagtgaagagatgggaacc
gaagcatacgacgaggctattgaagctctcaagaagcttctcatcgagaaggaagagcta
aagacggttgcagcggcaaaggtggagcagatcacagcggctcttcagacaggtacttca
tccgacaagaaagctttcgaccccgtcgaaaccattaagcagggcttcatcaaattcaag
aaggagaaatacgaaaccaaccctgctttgtacggtgagctcgcaaagggtcaaagtcct
aagtacatggtgtttgcttgttcagactcacgtgtgtgtccatcacacgttctggacttt
cagccaggagatgccttcgtggtccgtaacatagccaacatggttcctcctttcgacaag
gtcaaatacggtggcgttggagcagccattgaatacgcggtcttacaccttaaggtggag
aacattgtggtgataggacacagtgcatgtggtgggatcaaagggcttatgtctttcccc
ttagatggaaacaactccactgacttcatagaggactgggtcaaaatctgtttaccagcc
aagtcaaaggttatatcagaacttggagattcagcctttgaagatcaatgtggccgatgt
gaaagggaggcggtgaatgtttcactagcaaacctattgacatatccatttgtgagagaa
ggacttgtgaagggaacacttgctttgaagggaggctactatgacttcgtcaagggtgct
tttgagctttggggacttgaatttggcctctccgaaactagctctgttaaagatgtggct
accatactacattggaagctgtag

DBGET integrated database retrieval system