KEGG   Arabidopsis thaliana (thale cress): AT3G19480
Entry
AT3G19480         CDS       T00041                                 
Name
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00270  Cysteine and methionine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT3G19480
   00270 Cysteine and methionine metabolism
    AT3G19480
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT3G19480
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     AT3G19480
    1.1.1.399  2-oxoglutarate reductase
     AT3G19480
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT3G19480
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh PGDH_inter ACT IlvN AHAS-like_ACT AdoHcyase_NAD UDPG_MGDP_dh_C XdhC_C F420_oxidored NAD_binding_2 ACT_7
Other DBs
NCBI-GeneID: 821482
NCBI-ProteinID: NP_566637
TAIR: AT3G19480
UniProt: Q9LT69 A0A5S9XE93
Position
3:6752422..6754785
AA seq 588 aa
MATSLNLSSIFSSSSRLVTTPSSVFPIRQRRRIILVTSSSSGGGGKPTILVTEKLGQAGI
DLLKKYANVDCSYDLSLEELCTKISLCDALIVRSGTKVGRDVFESSRGRLKVVGRAGVGI
DNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARNIAQADASIKAGKWTRNKYVG
VSLVGKTLAVLGFGKVGSEVARRARGLGMHVITHDPYAPADRARAIGVELVSFEVAISTA
DFISLHLPLTAATSKMMNDVTFAMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALD
VFTVEPPVKDNKLVLHESVTATPHLGASTMEAQEGVSIEVAEAVIGALRGELAATAVNAP
MVPLEVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVTYASSRAPDDLDTRLLRAMVI
KGIIEPISSVFINLVNSDYIAKQRGVKISEERMVLDGSPENPIEYITVRIANVESRFASA
LSESGEIKVEGRVKQGVPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENV
NVSFMSVGRIAPGKQAVMAIGVDEQPSKETLKKIGDIPAIEEFVFLKL
NT seq 1767 nt   +upstreamnt  +downstreamnt
atggcgacgtctctgaatctatcatcgatcttctcctcctcctcaaggctcgtcaccact
ccctcctctgtttttcccatccgtcagaggcgacggatcatcctcgttacgtcttcttct
tccggaggtggaggaaaaccgacgattctcgtaacggagaagctaggccaagcggggatc
gatctgcttaagaagtacgctaatgtggattgctcttatgatctgagtctcgaggagctt
tgtacgaagatctctctttgtgatgcgctcatcgtcaggagtggtaccaaggttgggaga
gatgtgtttgaatcgtcgcgtgggaggcttaaggttgttggacgcgctggtgttgggatt
gataacgtcgatttggcggcggcgactgagtatgggtgtttggttgttaatgctccgact
gcgaacactgtggctgctgctgaacacggaattgcgcttttgaccgccatggctagaaac
attgctcaagctgatgcttctatcaaagctggcaaatggacgagaaacaagtatgtaggt
gtttcacttgtggggaagactcttgctgttcttggttttggtaaagttggatcagaggtt
gctagacgagccaggggacttggtatgcatgtcattacacatgatccttatgcaccagcg
gatcgtgcacgagctattggtgtggagcttgttagttttgaagtagctatttcaactgct
gacttcatctctttgcatctgcctcttactgctgctacttcgaagatgatgaatgatgtg
acctttgcgatgatgaagaaaggagtccgtattgttaatgttgctcgtggtggagttatt
gatgaggaagctcttttgagagcgcttgactcgggtattgttgctcaggcagctcttgat
gtttttacagtagagccacctgttaaagataataagttggtgttacatgagagtgtcact
gccacacctcatcttggtgctagtactatggaggctcaggaaggagtgtctatcgaagtc
gcagaagctgttattggagctttgagaggagaacttgctgctaccgcggtcaatgcacca
atggttccactagaggtattgagggagctgaagccgtatgttgtacttgctgagaagctt
gggaggctggctgtacaattggtaactggtggaagcggtgtgaatgctgtgaaagtgact
tatgcttcttccagagctcctgatgatctcgacactagacttctccgagccatggtcata
aaggggatcatcgaacccatttccagcgtattcataaatctggttaactccgattatatt
gccaaacaacgtggagtcaaaatctcagaagaacgtatggttctagacggctcacctgag
aatccaattgaatacataactgttcggatagcaaacgtggaatcaagatttgccagcgct
ttatcagagtccggtgagatcaaagtagaaggcagagtgaaacaaggggttccaagtctt
accaaagtcggattatttggagtggatgtgagtttagaagggagtgtgattctgtgcagg
caagtagatcagcctgggatgatcggtaaagttgctagcatcttaggagatgaaaacgtc
aacgtgagcttcatgagcgtcggtcgaatcgctccaggcaagcaagctgtgatggcaatt
ggagtagatgaacaaccaagcaaagaaactttgaagaaaatcggagacattcctgccatt
gaagagtttgttttcctcaaactatag

DBGET integrated database retrieval system