KEGG   Arabidopsis thaliana (thale cress): AT3G48430Help
Entry
AT3G48430         CDS       T00041                                 

Gene name
REF6
Definition
(RefSeq) relative of early flowering 6
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC JmjN zf-C2H2 zf-H2C2_2 zf-C2H2_4
Motif
Other DBs
NCBI-GeneID: 824002
NCBI-ProteinID: NP_680116
MIPS: AT3G48430.1
TAIR: AT3G48430
Araport: AT3G48430
UniProt: Q9STM3
Structure
PDB: 

Position
3
AA seq 1360 aa AA seqDB search
MAVSEQSQDVFPWLKSLPVAPEFRPTLAEFQDPIAYILKIEEEASRYGICKILPPLPPPS
KKTSISNLNRSLAARAAARVRDGGFGACDYDGGPTFATRQQQIGFCPRKQRPVQRPVWQS
GEEYSFGEFEFKAKNFEKNYLKKCGKKSQLSALEIETLYWRATVDKPFSVEYANDMPGSA
FIPLSLAAARRRESGGEGGTVGETAWNMRAMSRAEGSLLKFMKEEIPGVTSPMVYVAMMF
SWFAWHVEDHDLHSLNYLHMGAGKTWYGVPKDAALAFEEVVRVHGYGEELNPLVTFSTLG
EKTTVMSPEVFVKAGIPCCRLVQNPGEFVVTFPGAYHSGFSHGFNFGEASNIATPEWLRM
AKDAAIRRAAINYPPMVSHLQLLYDFVLALGSRVPTSINPKPRSSRLKDKARSEGERLTK
KLFVQNIIHNNELLSSLGKGSPVALLPQSSSDISVCSDLRIGSHLITNQENPIQLKCEDL
SSDSVVVDLSNGLKDTVSVKEKFTSLCERSRNHLASTEKDTQETLSDAERRKNDAAVALS
DQRLFSCVTCGVLSFDCVAIVQPKEAAARYLMSADCSFFNDWTAASGSANLGQAARSLHP
QSKEKHDVNYFYNVPVQTMDHSVKTGDQKTSTTSPTIAHKDNDVLGMLASAYGDSSDSEE
EDQKGLVTPSSKGETKTYDQEGSDGHEEARDGRTSDFNCQRLTSEQNGLSKGGKSSLLEI
ALPFIPRSDDDSCRLHVFCLEHAAEVEQQLRPFGGINLMLLCHPEYPRIEAEAKIVAEEL
VINHEWNDTEFRNVTREDEETIQAALDNVEAKGGNSDWTVKLGVNLSYSAILSRSPLYSK
QMPYNSIIYKAFGRSSPVASSPSKPKVSGKRSSRQRKYVVGKWCGKVWMSHQVHPFLLEQ
DLEGEESERSCHLRVAMDEDATGKRSFPNNVSRDSTTMFGRKYCRKRKIRAKAVPRKKLT
SFKREDGVSDDTSEDHSYKQQWRASGNEEESYFETGNTASGDSSNQMSDPHKGIIRHKGY
KEFESDDEVSDRSLGEEYTVRACAASESSMENGSQHSMYDHDDDDDDIDRQPRGIPRSQQ
TRVFRNPVSYESEDNGVYQQSGRISISNRQANRMVGEYDSAENSLEERGFCSTGKRQTRS
TAKRIAKTKTVQSSRDTKGRFLQEFASGKKNEELDSYMEGPSTRLRVRHQKPSRGSLETK
PKKIGKKRSGNASFSRVATEKDVEEKEEEEEEEENEEEECAAYQCNMEGCTMSFSSEKQL
MLHKRNICPIKGCGKNFFSHKYLVQHQRVHSDDRPLKCPWKGCKMTFKWAWSRTEHIRVH
TGARPYVCAEPDCGQTFRFVSDFSRHKRKTGHSVKKTNKR
NT seq 4083 nt NT seq  +upstreamnt  +downstreamnt
atggcggtttcagagcagagtcaagatgtgtttccatggcttaaatcgttaccggttgct
ccagagttcagacctactctagcagagtttcaagatccgatcgcttacattttgaagatt
gaagaagaagcttctagatatggaatctgtaaaattctgcctccactgcctcctccttcc
aaaaaaacctcgatttctaatctcaaccgttctctggcggcaagagcggcggcgagggtt
cgtgacggcggctttggcgcgtgtgattatgacggtggtcccacattcgccacgcgccag
cagcagatcgggttttgccctaggaaacagcgtccagtgcagagacctgtgtggcagagt
ggagaggagtactcttttggtgagttcgagtttaaagctaagaactttgagaagaattat
ctcaagaaatgtggtaaaaagagtcaactctctgcccttgaaattgaaacactttactgg
agagccactgtggataaacccttctctgttgagtatgccaatgacatgcctggctcggct
tttatccctctgagtctggctgctgcgaggaggagagagtctggtggtgaaggaggaaca
gttggtgagaccgcttggaacatgagggcaatgtctagagccgaaggatcattgcttaag
ttcatgaaggaagagatccctggagttacatcaccaatggtgtatgttgctatgatgttt
agttggtttgcttggcatgtggaggaccatgaccttcatagtctcaattacttgcatatg
ggtgctggtaagacttggtacggtgtgccaaaggatgctgctctggcttttgaggaggtt
gttagggttcatggttacggtgaagagctcaatcctcttgtgacattttctactcttggt
gagaagacaactgtgatgtctcctgaagtatttgttaaagccggaataccgtgttgcagg
ttagtgcaaaatcctggagagtttgtcgtcacctttccgggagcttatcattcgggattt
agtcatggatttaattttggagaagcatctaacattgccactcccgaatggttgagaatg
gctaaagatgctgctatccggcgagctgctataaattaccctccaatggtttctcatctc
cagctactttatgactttgtattggctctaggttctagagtgccaacaagcatcaatccc
aaaccacggagttctagattaaaagataaggcaagaagcgaaggagaaagattgaccaaa
aagctatttgtgcaaaacattatccacaacaacgaattgctttcttctctcggaaaagga
tccccagtggcccttctcccacagagttcctcagatatatcagtttgttctgacctgcga
attggatcccatttgataaccaaccaggaaaacccaatccagttaaagtgtgaggactta
agttctgatagtgttgtggttgatctcagtaacggtttaaaggatacagtttcagtgaaa
gaaaaatttacatctttatgtgaaaggagcagaaatcacctagcaagcacggagaaggac
actcaagaaactctgtctgatgctgaaaggaggaagaatgatgcagctgttgcgctttcg
gatcaaaggcttttctcttgtgttacatgtggagtcttaagctttgattgtgtagctatc
gttcaacctaaagaagcagctgctagatatctcatgtctgcagattgtagcttcttcaat
gattggacagctgcttctggatctgcaaatcttggtcaggctgcaagatcacttcatcct
caaagcaaagagaagcatgatgtaaattacttctacaatgttcctgttcaaactatggat
cattcagtgaagactggcgatcaaaaaacttcaacaacttccccgacaatagcgcataaa
gataatgatgttcttgggatgttagcttcagcatatggagactcttctgattccgaggaa
gaagatcaaaaaggcttagttacccctagttccaaaggggaaacaaaaacgtatgatcaa
gaaggttcagatggccatgaggaggctagagatggtagaacttctgattttaactgccag
agactaaccagcgaacagaatgggttaagcaaaggcggaaaatcatcacttctggaaata
gctttaccatttattccaagatctgatgacgattcatgtcggttgcacgtgttttgtctt
gagcatgctgcggaagtggaacagcaacttcgtccttttggggggattaacttaatgtta
ctgtgccatccagagtaccccaggatagaggctgaagcaaagatagttgccgaagagctc
gtcatcaatcacgaatggaatgatactgaattcaggaatgtgacccgagaggatgaggaa
acgattcaggcagcgttggataatgttgaagctaagggtgggaacagtgattggaccgta
aaattgggtgttaacctttcttacagcgctattctcagtcgctctcctctgtacagtaag
cagatgccgtataactccatcatatacaaggcgttcggtcgcagctctccagtagcgagc
tcaccctcgaaacccaaagtctctggtaaaagatcgtccagacagaggaaatatgttgtt
ggaaaatggtgtggtaaggtttggatgtcacatcaggtgcatccctttttgctggagcag
gacttagagggggaagaatctgaaagaagttgtcatcttcgagttgctatggatgaggat
gccactggaaagagatcgtttcctaataatgtttccagggattcgacaacaatgtttgga
agaaagtattgtaggaagagaaagataagagcaaaggcggtgccacgcaagaagcttact
tcttttaagagggaagatggagtttctgatgacacatcagaagatcattcttataagcag
caatggagggcttccgggaatgaggaagagtcttattttgagacagggaacacagcttct
ggtgattcatcaaatcaaatgtctgatccgcacaagggaattatcagacataaaggttat
aaagaatttgagtcagatgatgaggtttcagaccgttcacttggggaagagtatactgta
cgggcatgtgcagcttcagagagctcaatggagaatggctctcagcattcaatgtatgac
catgatgatgatgatgatgatatcgacaggcagcctagggggattccaaggagccaacag
acaagagtttttaggaatccagtttcatatgagtcagaagataatggcgtttatcagcaa
agcggaagaatatccataagtaataggcaagctaatcgaatggttggtgaatatgattca
gcagagaattctttggaggaacgaggcttttgcagtacagggaaaaggcaaaccaggtca
acagccaaacgaatagcaaaaaccaagacagttcagagttcgagagacacaaaaggtcgc
tttttgcaagaatttgcatctggaaagaagaatgaagaattggattcatacatggaggga
cctagcacacggcttagggtgagacatcagaagccgtcgagagggtctttagaaacaaaa
ccaaagaagattggtaagaagagaagtggtaatgcttccttctccagagttgcaactgaa
aaagatgtggaggaaaaagaagaagaagaagaagaagaagagaatgaggaagaggaatgt
gcagcataccaatgtaacatggagggttgcacgatgagtttcagttcggaaaaacagttg
atgttacacaaaagaaacatatgcccaattaaaggctgtggtaaaaacttcttctcacac
aagtatttggttcaacaccagcgtgttcactcagacgaccgtcctctgaaatgtccatgg
aagggatgtaagatgacgttcaagtgggcttggtctagaaccgagcacataagggttcac
acaggcgctaggccttatgtttgcgctgaaccggattgtggtcaaacattcaggtttgtc
tctgacttcagccggcataaaaggaagaccggtcattcggttaagaagaccaacaaaagg
tga

DBGET integrated database retrieval system